KEGG   Mycobacterium intracellulare MOTT-02: OCO_34600Help
Entry
OCO_34600         CDS       T01754                                 

Definition
hypothetical protein
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:mit00903]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3694372..3694779
Genome map
AA seq 135 aa AA seqDB search
MANTRTVEGFLNALQDADYEAADAALADDLVYENVGLPTIHGRARAMKLFRQMEGRAAFE
VKIHRIAADGGAVLTERTDALIFGPLRLQFWVCGVFEVHNGRITLWRDYFDFFDMLKATA
RGLAALVVPSLKAAF
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaacacccgcacggtcgagggattcctgaacgcgctgcaggacgccgattacgag
gccgccgacgccgctttggccgacgacctcgtctacgaaaacgtcggcctgcccaccatc
catggccgcgccagggccatgaagctgtttcgccagatggagggccgcgcggccttcgag
gtgaagatccaccgcatcgcggccgacggcggcgcggtgctcaccgaacgcaccgacgcg
ctgatcttcggccccctgcggctgcagttctgggtgtgcggtgtgttcgaggtgcacaac
gggcgaatcacgctgtggcgggactactttgactttttcgacatgctcaaggccaccgcg
cgcggcctggcggcgctggtggtgccgtcgctgaaagcggcgttctga

DBGET integrated database retrieval system