KEGG   Mycobacterium intracellulare MOTT-02: OCO_36770Help
Entry
OCO_36770         CDS       T01754                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCO_36770
   01230 Biosynthesis of amino acids
    OCO_36770
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCO_36770
   00030 Pentose phosphate pathway
    OCO_36770
   00051 Fructose and mannose metabolism
    OCO_36770
   00052 Galactose metabolism
    OCO_36770
  Energy metabolism
   00680 Methane metabolism
    OCO_36770
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    OCO_36770
Enzymes [BR:mit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     OCO_36770
Protein phosphatases and associated proteins [BR:mit01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     OCO_36770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3910623..3911654)
Genome map
AA seq 343 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRTCDSRYGSSVVGFQDGWRGLLENRRVQLHNDDRNDR
LLAKGGTMLGTARVNPDKLRAGLNQVKQTLDDNGIDVLIPIGGEGTLTAAHWLSEENVPV
VGVPKTIDNDIDCTDVTFGHDTALTVATEAIDRLHSTAESHQRVMLVEVMGRHAGWIALN
AGLASGAHMTLIPEQPFDVEEVCRLVKRRFQRGDSHFICVVAEGAKPIPGSIALREGGID
EFGHEKFTGVAAQLGAEVEKRINKDVRVTVLGHVQRGGTPTAYDRVLATRFGVNAADAAH
AGEYGQMVSLRGQDIGRVPLADAVRQLKLVPDSRYDDAAAFFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcggagtgctcaccggaggcggcgactgccccgggctcaacgccgtcatccgg
gcggtggtgcgtacgtgcgactcccggtacggctcgtcggtggtcggatttcaggacgga
tggcgcgggttgctggagaaccggcgcgtccagctgcacaacgacgaccgcaacgaccgc
ctgctggccaagggcggaacgatgctggggaccgcgcgcgtgaatcccgacaaacttcgg
gccgggctgaaccaggtcaagcagaccctcgacgacaacgggatcgacgtcctcatcccg
atcgggggggaaggcacgctgacggccgcgcactggctctccgaggaaaacgttcccgtg
gtcggcgtgccgaagaccatcgacaacgacatcgattgcacggacgtgactttcggccac
gacaccgcgttgaccgtcgccaccgaggcgatcgaccggttgcacagcaccgccgagtcc
caccagcgcgtgatgctggtcgaggtgatgggccggcacgcgggctggattgcgctgaac
gcgggcctggcttccggcgcgcacatgacgctgatccccgagcagccattcgacgtcgaa
gaggtctgccggctcgtcaaacgtcgcttccagcgcggagattcgcacttcatctgcgtg
gtcgccgagggcgccaaacccatacccggctcgattgcgttgcgggaaggcgggattgac
gagttcggccacgagaaattcaccggtgtggccgcgcagctgggcgccgaggtggaaaag
cgcatcaacaaggacgtccgcgtgaccgtcttgggtcacgtccagcgcggcggcaccccg
acggcatatgaccgggtgctggccacccggttcggcgtgaatgcggccgacgcggcgcat
gccggcgaatacggccagatggtgtcgctgcgcggccaggacatcggccgggtgccgctg
gccgatgccgtccgccagctcaagctggtgcccgacagccgctacgacgacgccgcggcc
ttcttcggctag

DBGET integrated database retrieval system