KEGG   Mycobacterium intracellulare MOTT-02: OCO_36990Help
Entry
OCO_36990         CDS       T01754                                 

Definition
glycosyl hydrolase family protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OCO_36990
Enzymes [BR:mit01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     OCO_36990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3933478..3935058
Genome map
AA seq 526 aa AA seqDB search
MNSTPDRVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLMRVLNTLAGEDRQ
GLITLGVTPVVNAQLDDPYCLGGMHHWLANWRLRAAEAASVRSIPRSKSAGYQSCTPEAL
RALGIREEAEAENALEDFATLWRHGGSAPLRGLLDAGTVELLGGPLAHPFQPLLAPRLRE
FALREGLADAGQRLAHTPTGIWAPECAYAPGLEHDYAAAGVTHFMVDGPSLHGDTALGRP
VGDTDVVAFGRDLQVSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGRNVPSEGKA
PYDPERADHAVDIHVADFVETVRNRLTSESARIGRPAHVIAAFDTELFGHWWYEGPTWLE
RVLRALPEAGVRVGTLTDAIADGFVGSPVALPPSSWGSGKDWQVWAGDQVADLVQLNNEV
VDTALSTVDKALSQTATLDGPIPRDHVADQILRETLLTVSSDWPFMVSKDSAADYARYRA
HLHAHATREIAGALASGRRDTAQRLAEGWNRADGLFGALDARRLPR
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
gtgaactcgacgccagaccgggtccccggcctgttcaccctggttttgcacacccatctt
ccgtggctggcccaccacggccgctggccggtcggtgaggaatggctgtatcaatcctgg
gcggcggcctacctgccgctgatgcgcgtgctgaacacgctggccggcgaggaccgccag
ggactgatcacgctcggcgtcacgccggtggtgaacgcgcaactcgacgacccgtattgc
cttggcggcatgcatcattggctggcgaactggcggctgcgcgcagccgaggcggccagt
gtgcggtcgattccccgatcgaagtcggccggctatcagtcgtgcacgccggaggcgttg
cgcgccttggggattcgcgaggaggcggaggccgagaacgcccttgaggacttcgccacc
ctatggcggcacggcggcagcgcgccgctgcgcgggttgctcgacgccggcacggtggag
ctgctcggcgggccgctggcccacccgttccaaccgctgctcgccccccgcctgcgcgag
ttcgccctgcgcgaggggctggccgacgccgggcagcggctggcgcacacccccaccggc
atctgggcgcccgaatgcgcgtacgcgcccgggctcgaacacgactacgccgccgccggg
gtcacgcacttcatggtcgacggcccgtcactgcacggcgacactgcgctgggccggccc
gtcggcgacaccgacgtggtggcgttcgggcgcgacctgcaggtcagctaccgggtgtgg
tcgccgaagtccggctaccccgggcacgccgcctatcgcgatttccacacctatgaccac
ctcaccgggctcaagccggccagggtcaccggccgcaacgtgccctcggaaggcaaggcg
ccctacgaccccgagcgggccgaccacgccgtcgacattcacgtcgccgacttcgtcgag
acggtccgcaaccgcctgacgagcgagtccgcgcgcatcgggcggcccgcgcatgtgatc
gccgccttcgacaccgagctgttcggccactggtggtacgagggcccgacctggttggag
cgggtgctgcgcgccctgcccgaggccggcgtgcgggtgggcaccctgaccgacgcgatc
gccgacggcttcgtcggtagcccggtggccctgccgcccagctcgtggggttcgggcaag
gactggcaggtgtgggccggcgaccaggtcgccgacctggtgcagctcaacaacgaagtg
gtcgacaccgcgctgagcaccgtcgacaaggcgctgtcccaaaccgcgacgctggacggg
cccatcccccgcgaccacgtcgccgaccagatcctgcgcgaaaccttgctgacggtctcc
agcgactggccgttcatggtgagcaaggattcggccgccgactacgcccgctaccgcgcc
cacctgcacgcgcacgccacccgtgagatcgcgggggcgctggcgtccgggcggcgcgac
accgcgcagcgcctggcggaggggtggaaccgcgcggacggactcttcggcgccctcgac
gcccgcaggttgccccgatga

DBGET integrated database retrieval system