KEGG   Mycobacterium intracellulare MOTT-02: OCO_39630Help
Entry
OCO_39630         CDS       T01754                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    OCO_39630
  Metabolism of other amino acids
   00480 Glutathione metabolism
    OCO_39630
Enzymes [BR:mit01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     OCO_39630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4190862..4191350
Genome map
AA seq 162 aa AA seqDB search
MTLKDIALNTLDGRPTTLAELSDGATLVVNVASKCGLTPQYTALEKLAKDYRDRGLTVVG
VPCNQFMGQEPGTADEIQEFCSTTYGVTFPLLAKTDVNGDGRHPLYAELTKAADADGQAG
DIQWNFEKFLLAPDGAVVQRFRPRTEPDAPEVISAIEAVLPR
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctcaaagacatcgccctgaacaccctcgacggccggcccaccacgctggccgaa
ttgtccgacggcgcaacgctcgtcgtcaacgtggcctccaaatgcgggctcactccgcag
tacacggcgctcgagaagctggccaaggactaccgcgaccgcggcctgaccgtcgtcggc
gtcccctgtaaccagttcatgggacaggaacccggcacggccgacgagatccaggagttc
tgctcgaccacctacggggtgacgttcccgttgttggcgaagaccgacgtcaacggcgac
ggccgccacccgctgtacgccgagttgaccaaagccgccgacgccgacggccaggcggga
gacatccagtggaacttcgagaagttcctcctcgcacccgacggtgcggtggtgcagcgc
ttccggccccgcaccgagcccgacgcccccgaggtcatcagcgccatcgaggccgtgctg
ccgcggtag

DBGET integrated database retrieval system