KEGG   Mycobacterium intracellulare MOTT-02: OCO_41610Help
Entry
OCO_41610         CDS       T01754                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    OCO_41610
Enzymes [BR:mit01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     OCO_41610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4397222..4398505)
Genome map
AA seq 427 aa AA seqDB search
MPPAFDAPTVIRTKRDGGRLSDAAIDWVVDAYTAGRVAEEQMAALLMAILLRGMDRGETA
RWTSAMLASGERLDFGDLGVPTVDKHSTGGVGDKITLPLVPVVAACGAAVPQASGRGLGH
TGGTLDKLESIAGFTAALSNRRVRDQLRDLGAAIFAAGDLAPADAKLYALRDITATVESL
PLIASSVMSKKLAEGAGALVLDVKVGSGAFTDSEAQSRDLASTMVALGAAHGVPTRALLT
DMNTPLGATVGNALEVAESLEVLAGGGPPDVVELTLRLASEMLELAGVDGRDPAETLRDG
TAMDRFRQLVAAQGGDLSVPLPIARHAETVTAARGGTMGDIDAMAVGLAAWRLGAGRSRP
GDRVQFGAGIRLHRRPGEPVTAGEPLFTLYTDTPERFGAALAELDGAFGVGDAAPASRPL
IIDRIAQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccgcctttgatgcgcccacggtgatcaggaccaagcgcgacggcggccggttg
tccgacgccgccatcgactgggtcgtcgacgcctacaccgccggccgggtggccgaggag
cagatggcggccctgctgatggcgatcctgttgcggggcatggatcgcggcgagacggcc
cggtggacgtcggcgatgctggcctcgggcgagcggctcgacttcggcgacctcggcgtg
cccacggtcgacaagcactccaccggcggggtgggggacaagatcaccctgcccctggtg
cccgtcgtcgccgcgtgcggcgccgcggtgccgcaggcgtcgggccgcgggctcggccac
accggcggcacgctggacaagctggaatccatcgccggattcaccgccgcgctgtccaac
cggcgggtgcgcgaccaactgcgcgacctcggcgcggccatcttcgccgccggtgacctg
gccccggccgacgccaagctgtacgcgctgcgcgacatcaccgccaccgtcgagtcgctg
ccgctgatcgcgagctcggtgatgagcaagaagctggccgagggggccggcgcgctggtg
ctcgacgtgaaggtcggttccggggcgttcaccgactcggaagcgcagtcccgcgacctg
gcgagcaccatggtcgcgctgggcgccgcgcacggggtgcccacccgcgcgctgctgacg
gacatgaacaccccgctgggcgcgaccgtcggcaacgccctcgaggtcgccgagtcgctc
gaggtgctggccgggggcgggccgcccgacgtcgtcgagctgacgctgcggctggcctcc
gagatgctcgagctggccggggtcgacggccgcgatcccgccgagacactgcgggatggc
accgcgatggaccggtttcgccagctcgtcgccgcccagggcggcgatttgtcggtgccg
ctgccgatcgctcggcatgccgagaccgtgaccgccgcccggggcggcacaatgggcgat
atcgacgcgatggcagtggggctggcggcttggcggctcggagcgggcagatcccgtccg
ggcgatcgcgtgcagttcggcgccggcatccggctgcatcgccgccccggcgagccggtc
acggccggtgagccgctgttcaccctgtacaccgacaccccggagcgcttcggcgcggcg
ctcgccgagctggacggcgccttcggcgtcggcgacgccgccccggcttcgcgtccgctg
atcatcgatcggatcgcgcaatga

DBGET integrated database retrieval system