KEGG   Mycobacterium intracellulare MOTT-02: OCO_41640Help
Entry
OCO_41640         CDS       T01754                                 

Definition
(RefSeq) succinate dehydrogenase hydrophobic membrane anchor protein SdhD
  KO
K00242  
succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCO_41640
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OCO_41640
   00650 Butanoate metabolism
    OCO_41640
  Energy metabolism
   00190 Oxidative phosphorylation
    OCO_41640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4399514..4399984
Genome map
AA seq 156 aa AA seqDB search
MSSPDLQLTRGQTAPVKQRSYDRPASLDNPRSPRRRAGIPNFEKFAWLFMRFSGIALFVL
AIGHLFIMLMWDNGVYRIDFNYVAQRWASPFWQFWDLALLWLAQLHGGNGLRTIIDDYSR
KDSTRFWLNSLLLLSMGFTLVLGTYVLLTFDPNIHA
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccccgaccttcagctgacccgcggccagacggcgccggtcaaacaacgcagc
tacgaccggcccgccagcctggacaatccccgctcgccgcggcgccgggccggcatcccc
aacttcgagaagttcgcctggctgttcatgcggttctcgggcatcgcgctgttcgtgctg
gcgatcggccacctgttcatcatgctgatgtgggacaacggcgtgtaccgcatcgacttc
aactatgtggcgcagcgctgggcgtcgccgttctggcaattctgggacctcgcgctgctg
tggctggcgcagctgcacggcggcaacggcctgcgcacgatcatcgacgactacagccgc
aaggacagcacccggttctggctcaacagcctgctgttgctgtcgatggggttcacgttg
gtgctgggcacctacgtgctgctgacgttcgaccccaacattcacgcctga

DBGET integrated database retrieval system