KEGG   Mycobacterium intracellulare MOTT-02: OCO_41640Help
Entry
OCO_41640         CDS       T01754                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein SdhD
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:mit01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mit00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mit00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:mit00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4399514..4399984
Genome map
AA seq 156 aa AA seqDB search
MSSPDLQLTRGQTAPVKQRSYDRPASLDNPRSPRRRAGIPNFEKFAWLFMRFSGIALFVL
AIGHLFIMLMWDNGVYRIDFNYVAQRWASPFWQFWDLALLWLAQLHGGNGLRTIIDDYSR
KDSTRFWLNSLLLLSMGFTLVLGTYVLLTFDPNIHA
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccccgaccttcagctgacccgcggccagacggcgccggtcaaacaacgcagc
tacgaccggcccgccagcctggacaatccccgctcgccgcggcgccgggccggcatcccc
aacttcgagaagttcgcctggctgttcatgcggttctcgggcatcgcgctgttcgtgctg
gcgatcggccacctgttcatcatgctgatgtgggacaacggcgtgtaccgcatcgacttc
aactatgtggcgcagcgctgggcgtcgccgttctggcaattctgggacctcgcgctgctg
tggctggcgcagctgcacggcggcaacggcctgcgcacgatcatcgacgactacagccgc
aaggacagcacccggttctggctcaacagcctgctgttgctgtcgatggggttcacgttg
gtgctgggcacctacgtgctgctgacgttcgaccccaacattcacgcctga

DBGET integrated database retrieval system