KEGG   Mycobacterium intracellulare MOTT-02: OCO_43290Help
Entry
OCO_43290         CDS       T01754                                 

Definition
(GenBank) L-fuculose-phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
mit00051  Fructose and mannose metabolism
mit01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    OCO_43290
Enzymes [BR:mit01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     OCO_43290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AFC50692
Position
4563972..4564625
Genome map
AA seq 217 aa AA seqDB search
MKFVENAETAVLDAAKDMLRRGLVEGTAGNISARRADGNIVITPSSVDYRDMQLDDLVLV
DPGGSVLQAADGRSPSSEMQLHLACFAAFDDIGSVIHSHPVWATMFAIAHQPIPACIDEF
AVYCGGDVRCTDYAASGTADVGTNAVAALEGRAAALIANHGLVAVGPRPDKVLHVTALVE
RTAQIVWGARALGGPVPIPEDVNKNFAAVYGYLRANA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcgtcgagaacgcggagaccgcggtgctggacgcggccaaggacatgctgcgc
cggggcctggtggagggcaccgccggcaacatctcggcgcgccgcgccgacggcaacatc
gtcatcaccccgtcttccgtcgactaccgcgacatgcagctcgacgacctcgtgctggtc
gatccgggcggctcggtgctgcaggcggccgatggccggtcgccgtcttcggagatgcag
ttgcacctggcctgctttgccgcgttcgacgacatcggcagcgtcattcacagtcatccg
gtgtgggcgaccatgttcgccatcgcccaccaaccgatcccggcgtgcatcgacgagttc
gcggtgtattgcggcggggacgtccggtgcaccgattacgccgcgtccgggaccgccgac
gtgggtaccaacgcggtcgccgcgctcgagggccgcgccgccgccctgatcgccaaccac
ggcctggtggcggtgggaccgcggcccgacaaggttttacatgtcaccgcgctggtggag
cgcaccgcccaaatcgtttggggcgcacgcgctctcggggggccggtgccgatccccgag
gacgtcaacaaaaacttcgccgcggtctacggttatctgcgggccaacgcctga

DBGET integrated database retrieval system