KEGG   Mycobacterium intracellulare MOTT-02: OCO_44360Help
Entry
OCO_44360         CDS       T01754                                 

Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mit03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4665093..4666814
Genome map
AA seq 573 aa AA seqDB search
MTADVMFATGLLRTFSDAGVFEAADVHVAQRLTALTGESDERVALAVALVVRALRGGSVC
VDLRAAPGLLGDADLPWPGADDWLAAVRASALLGPPPVLRFFGDLLYFDRYWLEEEQVCT
DLLALSAPPVGIESSSYERLFEPGYEEQRAAAEIAVSQAVTVLTGGPGTGKTTTIARLLA
LLLEHAERAGMPPPRIALAAPTGKAAARLAEAVAAGARRLGAADRARLAGLSGTTLHRLL
GPRPDTSVRFKHNRANRLPHDVIVVDETSMVSLTMMARLAEAVRPDSRLILVGDPDQLAS
VEAGAVLADLVDGLSARGDVRVAALRTPHRYGTSIGALAEAIRVGDADRVVELLAAGGEH
VEWVDAQRPADRLREVLVAHALRLRSAALLGAADEALATLDEHRLLCAHREGPYGATHWN
TLVQKWIAEATGQPAWSQWYAGRPLLVTANDYGLRLYNGDTGVAVAGAEGLRAVIAGASG
PLDFATSRLGEVETMHAMTIHKSQGSQADEVTVLIPPEDSRLLTRELFYTAVTRAQTRVR
VVGPEASVRAAIERRAMRATGLRQRLRADAAAT
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgacggcagacgtgatgttcgcgaccggattgctgcgcacgttcagcgatgccggcgtc
ttcgaggcggcggacgtgcatgtggcgcaacggcttaccgcgctcaccggcgagtccgac
gaacgggtcgccctggcggtcgcgctggtggtgcgcgcgctgcggggcggttcggtctgc
gtcgatctccgcgcggcgcccgggctgctcggcgacgccgacctgccgtggcccggcgcc
gacgactggctggcggcggtgcgcgccagcgcgttgctcgggccgccgccggtgctgcgg
tttttcggcgatctgctgtacttcgaccggtactggctcgaggaggagcaggtgtgcacc
gacctgctggccctgtcggcgccgccggtcggcatcgaatcgtccagttacgaacggctt
ttcgagcccgggtacgaggagcagcgggccgccgccgaaatcgcggtgtcgcaggcggtg
accgtgctgaccggtggccccggcaccggcaagaccaccacgatcgcgcggctgctcgcc
ctgctcctcgagcatgccgagcgggccgggatgccgccgccgcggatcgcgctggccgca
ccgaccggcaaggcggcggcgcggctggccgaggcggtggccgcgggggcccgacggctc
ggcgcggccgaccgggcgcggctggccggcctgtccgggaccacgctgcaccggctgctg
ggtccccggccggatacgtcggtgcggttcaagcacaatcgcgccaaccggctgccgcac
gacgtcatcgtggtggacgagacgtcgatggtgtcgttgacgatgatggcccggctggcc
gaagcggtccgcccggactcccggttgattctggtcggcgacccggaccagttggcctcg
gtggaggcgggcgccgtgctggccgacctggtggacgggctgtccgcccgcggcgacgtg
cgggtggccgccctgcgcacgccgcaccgatacggcacgtcgatcggcgcgctggccgag
gcgattcgggtcggcgacgcggaccgggtggtggagctgctggcggccgggggcgagcac
gtcgagtgggtggatgcacagcgcccggccgatcggctgcgcgaggtgctcgtcgcgcac
gcgctgcggctgcggtcggccgcgctcctgggcgcggccgacgaggcgctggccacgctg
gacgaacaccggctgctgtgcgcgcaccgcgagggcccgtatggggcgacacactggaac
acgttggtgcagaagtggattgccgaggcgacggggcagccggcatggtcgcagtggtac
gccgggcgcccgctgctggtgaccgccaacgactacggcctgcggctctacaacggcgac
accggtgtggcggtggccggcgcggagggcctgcgggcggtcatcgccggcgcgagtggg
ccgctagacttcgcgaccagccgcctcggcgaggtggagacgatgcacgccatgaccatc
cacaagagtcagggcagccaggccgacgaggtgaccgtgctgataccgccggaggattcg
cgactgctgacgcgggaactgttctacacggccgtgacccgggcgcagaccagggtgcgg
gtggtggggcccgaggcctcggtgcgcgcggcgatcgagcgccgggcgatgcgggccacc
ggattgcggcaacggctgcgggccgacgccgccgcaacgtga

DBGET integrated database retrieval system