KEGG   Mycobacterium intracellulare MOTT-02: OCO_45540Help
Entry
OCO_45540         CDS       T01754                                 

Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
mit00010  Glycolysis / Gluconeogenesis
mit00260  Glycine, serine and threonine metabolism
mit00680  Methane metabolism
mit01100  Metabolic pathways
mit01110  Biosynthesis of secondary metabolites
mit01120  Microbial metabolism in diverse environments
mit01130  Biosynthesis of antibiotics
mit01200  Carbon metabolism
mit01230  Biosynthesis of amino acids
Module
mit_M00002  Glycolysis, core module involving three-carbon compounds
mit_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCO_45540
  Energy metabolism
   00680 Methane metabolism
    OCO_45540
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OCO_45540
Enzymes [BR:mit01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     OCO_45540
Membrane trafficking [BR:mit04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    OCO_45540
Exosome [BR:mit04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   OCO_45540
  Exosomal proteins of melanoma cells
   OCO_45540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFC50917
Position
complement(4793286..4794035)
Genome map
AA seq 249 aa AA seqDB search
MGDSATLILLRHGESEWNSLNLFTGWVDVGLTDKGRTEAVRSGELLAEHNLLPDVLYTSL
LRRAISTAHLALDAADRLWIPVRRTWRLNERHYGALQGLDKAETKARYGDDQFMAWRRSY
DTPPPPIEKGSTYSQDTDPRYADIGGGPLTECLADVVVRFLPYFTDVIVPDLRSGKTVLI
VAHGNSLRALVKHLDRMSDDDIVGLNIPTGIPLRYDLDADLRPVVPGGTYLDPEAAAAGA
AAVAGQGRG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgggtgactccgccacgctgatcctgctccgccacggtgaaagcgaatggaattcgctg
aacctgttcaccggttgggtggacgtcgggctgaccgacaagggccgcaccgaggcggtg
cgcagcggcgagctgctggccgaacacaatctgttgcccgacgtcctctacacgtcgctg
ctgcgccgggccatctccaccgcgcacctggcgctggacgccgccgaccggctgtggatc
ccggtgcggcgcacctggcggctcaacgaacgccattacggggcgctgcagggcctggac
aaggccgagaccaaggcgcgctacggcgacgaccagttcatggcctggcgacgcagctac
gacacgccgcccccgccgatcgagaagggcagcacctacagccaggacaccgatccccgc
tacgctgacatcggcggcgggccgctgaccgagtgcctcgccgacgtggtcgtccgtttc
ctgccgtatttcaccgacgtcatcgtcccggacctgcgcagcggcaagacggtgctgatc
gtcgcgcacggcaactcgctgcgggccctggtcaagcacctcgatcggatgtccgacgac
gacatcgtgggcctgaacatcccgaccggcatcccgctgcgctacgacctggacgccgac
ctgcgcccggtggtgcccggcggcacctatctggaccccgaggcggccgccgccggtgcc
gccgcggtcgccggccagggacgcggctga

DBGET integrated database retrieval system