KEGG   Mycobacterium intracellulare MOTT-02: OCO_48310Help
Entry
OCO_48310         CDS       T01754                                 

Definition
glycosyl hydrolase family protein 3 (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    OCO_48310
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    OCO_48310
Enzymes [BR:mit01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     OCO_48310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5066275..5067426)
Genome map
AA seq 383 aa AA seqDB search
MAFSRTFAVLAAASALVAGCGHHPAPPAHSSTSSKPAAAPAPPVCADPAAVPAALGIRDK
LAQLLMVGVKNADDARAVVNGYHVGGIFIGSWTDLAIFQGPLADISAKAGPLPLAVSVDE
EGGRVSRLKTLIGTSPPARELAQTQTVQQVHDLAADRGRKMRDLGITVDFAPVVDVSDED
DDAVIGNRSFGADPQTVTDYAGAYARGLRDAGLLPVLKHFPGHGHGSGDSHTGGVVTPPL
ADLQTSDLVPYRSLVAAAPVAVMVGHLQVPGLTGDVPASLSPEAVQLLRNGVGYKGPPFT
GPVFSDDLSSMAAISDRYGVSEAVLRSLLAGVDVALWVTTDEVPAVLDRLQKAVASGELP
ARRVDEALVRVAKMKGPGPTCGH
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcattttcgcgcaccttcgccgtgcttgcggccgcgtcggcgctggtggccggctgc
ggccaccaccccgcgccacccgcccactcgtcgacgtcgagcaagccggcggccgcgccg
gcccccccggtgtgcgccgacccggcggcggtgccggccgcgctgggcatccgcgacaag
ctggcccaactcctgatggtgggcgtgaagaacgccgacgacgcccgggccgtcgtcaac
ggctaccacgtcggcgggatcttcatcggcagctggaccgacctcgcaatcttccagggg
ccgttggcggacatcagcgccaaggcgggaccgctgccgctggcggtcagcgtcgacgaa
gagggtgggcgggtgtcgcggctgaagaccctgatcgggacgtcgccgccggcccgggag
ctggcgcagacacaaaccgtccagcaggtccacgatttggccgccgaccgcggccgcaag
atgcgcgacctgggcatcaccgtcgacttcgctcccgtggtcgacgtcagcgacgaggac
gacgacgccgtcatcggcaaccgttccttcggcgcggacccgcagacggtgaccgactac
gccggggcgtacgcgcggggcctccgcgacgccgggctgctgccggtgctcaagcatttc
cccgggcacgggcacggctcgggtgattcgcacaccggcggtgtggtcacgccgccgctc
gccgacctgcagaccagtgacctggtgccctaccggtcgctggtggccgcggcgccggtc
gcggtgatggtgggccacctgcaggtcccgggcctcaccggcgatgtccccgccagcctg
agccccgaggcggtgcaattgctgcgaaacggcgtcggctacaagggtccgccgttcacc
ggcccggtgttcagcgacgacctgtccagcatggccgccatctccgaccggtacggggtg
tcggaggcggtgctgcgcagcctgttggccggcgtcgacgtcgcgctgtgggtcaccacc
gacgaggtgcccgcggtgctggaccgcttgcaaaaggccgtcgcctcaggcgaactgccg
gcacgccgggtggacgaggcgctggtgcgggtggcgaagatgaagggccccggcccgacc
tgcgggcactag

DBGET integrated database retrieval system