KEGG   Methanocaldococcus jannaschii: MJ_0172Help
Entry
MJ_0172           CDS       T00003                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mja  Methanocaldococcus jannaschii
Brite
Enzymes [BR:mja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     MJ_0172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(175180..175827)
Genome map
AA seq 215 aa AA seqDB search
MDLEEQKKAVIEKLIREGYIKSKRVIDALLKVPREEFLPEHLKEYAYVDTPLEIGYGQTI
SAIHMVGMMCELLDLKPGMKVLEIGTGCGYHAAVTAEIVGEDGLVVSIERIPELAEKAER
TLRKLGYDNVIVIVGDGTLGYEPLAPYDRIYTTAAGPKIPEPLIRQLKDGGKLLMPVGRY
LQRLVLAEKRGDEIIIKDCGPVAFVPLVGKEGFQG
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggatttagaagaacaaaagaaagcagtaattgagaaattaattagggaggggtatata
aaaagtaaaagagtaattgatgctctattaaaagttccaagggaggaatttcttccagag
catttaaaggaatatgcgtatgtagatactccattagagattggttatgggcagactatt
tcagccattcatatggttggaatgatgtgtgagcttttagatttaaagccaggaatgaaa
gttttagagattgggactggttgtggttatcacgcggcagtaactgctgagattgtgggg
gaggatggtttagttgttagtattgagagaattccagaattggctgaaaaagcagagaga
actttaaggaaattgggatacgataacgttattgtaatagtgggagatggaactttaggg
tatgagccattagccccttatgataggatatatacaactgcagcaggtccaaaaatccca
gaaccattaataaggcaattaaaagatgggggaaagttattaatgcctgttggtaggtat
ctacaaagattagttttagctgaaaagagaggagatgagataataataaaggactgtggg
ccagtggcatttgttcctttagttggtaaagaaggattccaagggtaa

DBGET integrated database retrieval system