KEGG   Methanocaldococcus jannaschii: MJ_0199Help
Entry
MJ_0199           CDS       T00003                                 

Definition
ferredoxin
Organism
mja  Methanocaldococcus jannaschii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
192373..192570
Genome map
AA seq 65 aa AA seqDB search
MVIMAVTIDYSLCKGAECAECVNNCPMEVFEIEGDKVVVARPDDCTYCGVCEDVCPTGAV
KVEPE
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
gtggtaataatggctgtaacaatagattacagcttatgtaaaggggcagagtgtgcagaa
tgtgtaaataactgcccaatggaagtttttgaaattgagggagataaagtagttgttgca
agacctgatgactgcacttattgtggagtctgtgaagatgtctgtccaacaggagctgta
aaagttgaaccagaataa

DBGET integrated database retrieval system