KEGG   Methanocaldococcus jannaschii: MJ_0210Help
Entry
MJ_0210           CDS       T00003                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mja00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MJ_0210
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MJ_0210
   00640 Propanoate metabolism
    MJ_0210
   00660 C5-Branched dibasic acid metabolism
    MJ_0210
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MJ_0210
Enzymes [BR:mja01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MJ_0210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
201040..202134
Genome map
AA seq 364 aa AA seqDB search
MKLHEYEAKNIFKKYGIPVPESFLVSKEDDLNSINVDKEVVLKAQVLVGGRGKAGGILFA
SNKEEFIKKAEELFNKEVKGEKVEKILVEEKLPIEKEYYVSIIIDRDAKKPLIIFSTEGG
VDIEEVAEKNPEKIIKYHIDVRKPFLPYIARWIVKEAKLPSNEIGKVADVIYKLYKIFKE
LDATMVEINPLVITKDGNVYAADAVLHLDDDAAFRHNYEEFEEYKNKEKLPFAYVELDGD
VAVIGNGAGLTLASMDIINNLGRKPACFLDIGGGADAETVKLALRKVLENKNVKGIFINI
LGGITRCDEVAKGIVEVLKEHPNVKFAVRMMGTNEEIGRKILEEHGIPYETSMEEAGRKL
IEQL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacatgaatatgaagctaaaaatatatttaaaaagtatggtatcccagttcct
gagagctttttagtatctaaggaagatgatttaaacagtataaatgttgataaagaagtt
gttttaaaagcccaagttttagttggtggaagaggaaaagcaggaggaattttatttgca
tcaaataaagaagaattcataaagaaagcagaagagttgtttaataaagaagttaaagga
gaaaaagttgaaaaaattttagttgaagagaaattgccaatagaaaaagaatactatgta
tcaattatcatagacagagatgctaaaaaaccgttaatcatcttctcaactgagggagga
gttgatattgaagaagtcgctgaaaagaatccagaaaagattataaagtaccatattgat
gttagaaaacctttcctcccttatattgcaagatggatagttaaagaggcaaaattgcca
agcaatgagattggaaaggttgctgatgttatttataagttatacaaaatctttaaagag
ttggatgctacaatggttgaaatcaatccattggttataactaaagatggaaacgtctat
gccgctgatgctgttcttcacttagatgatgatgcagcatttagacataactatgaagaa
tttgaagaatataaaaataaagaaaaattaccatttgcctacgttgagttggatggagat
gtggcagttataggtaatggagctggtttaactttggcaagtatggatattataaataac
ctcggcagaaagccagcttgcttcttagatattggaggaggggctgatgctgaaactgta
aaattggctttgagaaaggttttagaaaacaaaaatgttaagggaatatttattaatatt
ttaggaggaataacaaggtgtgatgaagtagcaaagggaattgttgaagttttaaaagaa
catccaaatgtaaagtttgctgttagaatgatgggaactaatgaagagattggaagaaaa
atattggaagaacatggaataccttatgagacatcaatggaagaagcaggaagaaaattg
attgaacagctataa

DBGET integrated database retrieval system