KEGG   Methanocaldococcus jannaschii: MJ_0210Help
Entry
MJ_0210           CDS       T00003                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mja00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MJ_0210
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MJ_0210
   00640 Propanoate metabolism
    MJ_0210
   00660 C5-Branched dibasic acid metabolism
    MJ_0210
Enzymes [BR:mja01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MJ_0210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
201040..202134
Genome map
AA seq 364 aa AA seqDB search
MKLHEYEAKNIFKKYGIPVPESFLVSKEDDLNSINVDKEVVLKAQVLVGGRGKAGGILFA
SNKEEFIKKAEELFNKEVKGEKVEKILVEEKLPIEKEYYVSIIIDRDAKKPLIIFSTEGG
VDIEEVAEKNPEKIIKYHIDVRKPFLPYIARWIVKEAKLPSNEIGKVADVIYKLYKIFKE
LDATMVEINPLVITKDGNVYAADAVLHLDDDAAFRHNYEEFEEYKNKEKLPFAYVELDGD
VAVIGNGAGLTLASMDIINNLGRKPACFLDIGGGADAETVKLALRKVLENKNVKGIFINI
LGGITRCDEVAKGIVEVLKEHPNVKFAVRMMGTNEEIGRKILEEHGIPYETSMEEAGRKL
IEQL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacatgaatatgaagctaaaaatatatttaaaaagtatggtatcccagttcct
gagagctttttagtatctaaggaagatgatttaaacagtataaatgttgataaagaagtt
gttttaaaagcccaagttttagttggtggaagaggaaaagcaggaggaattttatttgca
tcaaataaagaagaattcataaagaaagcagaagagttgtttaataaagaagttaaagga
gaaaaagttgaaaaaattttagttgaagagaaattgccaatagaaaaagaatactatgta
tcaattatcatagacagagatgctaaaaaaccgttaatcatcttctcaactgagggagga
gttgatattgaagaagtcgctgaaaagaatccagaaaagattataaagtaccatattgat
gttagaaaacctttcctcccttatattgcaagatggatagttaaagaggcaaaattgcca
agcaatgagattggaaaggttgctgatgttatttataagttatacaaaatctttaaagag
ttggatgctacaatggttgaaatcaatccattggttataactaaagatggaaacgtctat
gccgctgatgctgttcttcacttagatgatgatgcagcatttagacataactatgaagaa
tttgaagaatataaaaataaagaaaaattaccatttgcctacgttgagttggatggagat
gtggcagttataggtaatggagctggtttaactttggcaagtatggatattataaataac
ctcggcagaaagccagcttgcttcttagatattggaggaggggctgatgctgaaactgta
aaattggctttgagaaaggttttagaaaacaaaaatgttaagggaatatttattaatatt
ttaggaggaataacaaggtgtgatgaagtagcaaagggaattgttgaagttttaaaagaa
catccaaatgtaaagtttgctgttagaatgatgggaactaatgaagagattggaagaaaa
atattggaagaacatggaataccttatgagacatcaatggaagaagcaggaagaaaattg
attgaacagctataa

DBGET integrated database retrieval system