KEGG   Methanocaldococcus jannaschii: MJ_0210Help
Entry
MJ_0210           CDS       T00003                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mja01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mja00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mja00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:mja00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
201040..202134
Genome map
AA seq 364 aa AA seqDB search
MKLHEYEAKNIFKKYGIPVPESFLVSKEDDLNSINVDKEVVLKAQVLVGGRGKAGGILFA
SNKEEFIKKAEELFNKEVKGEKVEKILVEEKLPIEKEYYVSIIIDRDAKKPLIIFSTEGG
VDIEEVAEKNPEKIIKYHIDVRKPFLPYIARWIVKEAKLPSNEIGKVADVIYKLYKIFKE
LDATMVEINPLVITKDGNVYAADAVLHLDDDAAFRHNYEEFEEYKNKEKLPFAYVELDGD
VAVIGNGAGLTLASMDIINNLGRKPACFLDIGGGADAETVKLALRKVLENKNVKGIFINI
LGGITRCDEVAKGIVEVLKEHPNVKFAVRMMGTNEEIGRKILEEHGIPYETSMEEAGRKL
IEQL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacatgaatatgaagctaaaaatatatttaaaaagtatggtatcccagttcct
gagagctttttagtatctaaggaagatgatttaaacagtataaatgttgataaagaagtt
gttttaaaagcccaagttttagttggtggaagaggaaaagcaggaggaattttatttgca
tcaaataaagaagaattcataaagaaagcagaagagttgtttaataaagaagttaaagga
gaaaaagttgaaaaaattttagttgaagagaaattgccaatagaaaaagaatactatgta
tcaattatcatagacagagatgctaaaaaaccgttaatcatcttctcaactgagggagga
gttgatattgaagaagtcgctgaaaagaatccagaaaagattataaagtaccatattgat
gttagaaaacctttcctcccttatattgcaagatggatagttaaagaggcaaaattgcca
agcaatgagattggaaaggttgctgatgttatttataagttatacaaaatctttaaagag
ttggatgctacaatggttgaaatcaatccattggttataactaaagatggaaacgtctat
gccgctgatgctgttcttcacttagatgatgatgcagcatttagacataactatgaagaa
tttgaagaatataaaaataaagaaaaattaccatttgcctacgttgagttggatggagat
gtggcagttataggtaatggagctggtttaactttggcaagtatggatattataaataac
ctcggcagaaagccagcttgcttcttagatattggaggaggggctgatgctgaaactgta
aaattggctttgagaaaggttttagaaaacaaaaatgttaagggaatatttattaatatt
ttaggaggaataacaaggtgtgatgaagtagcaaagggaattgttgaagttttaaaagaa
catccaaatgtaaagtttgctgttagaatgatgggaactaatgaagagattggaagaaaa
atattggaagaacatggaataccttatgagacatcaatggaagaagcaggaagaaaattg
attgaacagctataa

DBGET integrated database retrieval system