KEGG   Methanocaldococcus jannaschii: MJ_0269Help
Entry
MJ_0269           CDS       T00003                                 

Definition
pyruvate ferredoxin oxidoreductase subunit gamma (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:mja01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mja00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mja00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mja00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mja00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mja00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:mja00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:mja00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(255362..255898)
Genome map
AA seq 178 aa AA seqDB search
MIEIRFHGRGGQGAVTAAQILAKAAFYDGKFCQAFPFFGVERRGAPVMAFTRIDDKKITL
RCQIYEPDYVIVQDATLLESVNVVEGLKKDGAVVINTVKDDLDLGYKTYTIDATGIALDV
LGVPIVNTAMVGAFAGVTGIVSIESVKKAILDTFKGKLGEKNAKAAEVAYNEMLKKYG
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaattagatttcacggaagaggaggacaaggagctgttacagcagcacaaatt
ttagctaaagctgctttttatgatggaaagttttgtcaagcatttccattctttggtgtt
gagagaagaggggctccagttatggcattcacaagaatagacgataagaagataacatta
agatgccaaatctatgagccagattatgttattgttcaggatgctactcttttagagagt
gttaatgttgttgaggggttaaagaaagatggcgctgttgtaattaacactgttaaggat
gatttagatttaggctacaaaacatatacaattgatgctacaggaatagcgttagatgtt
ttaggagttccaattgtaaatactgcaatggttggagcttttgctggagttacaggaatt
gttagcatagaatcagttaaaaaagctattttagatacatttaaaggtaaattaggagag
aaaaacgctaaagctgctgaagtagcatacaatgagatgttaaaaaaatatggataa

DBGET integrated database retrieval system