KEGG   Methanocaldococcus jannaschii: MJ_0269Help
Entry
MJ_0269           CDS       T00003                                 

Definition
pyruvate ferredoxin oxidoreductase subunit gamma (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mja00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MJ_0269
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MJ_0269
   00020 Citrate cycle (TCA cycle)
    MJ_0269
   00620 Pyruvate metabolism
    MJ_0269
   00640 Propanoate metabolism
    MJ_0269
   00650 Butanoate metabolism
    MJ_0269
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MJ_0269
   00680 Methane metabolism
    MJ_0269
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MJ_0269
Enzymes [BR:mja01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MJ_0269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(255362..255898)
Genome map
AA seq 178 aa AA seqDB search
MIEIRFHGRGGQGAVTAAQILAKAAFYDGKFCQAFPFFGVERRGAPVMAFTRIDDKKITL
RCQIYEPDYVIVQDATLLESVNVVEGLKKDGAVVINTVKDDLDLGYKTYTIDATGIALDV
LGVPIVNTAMVGAFAGVTGIVSIESVKKAILDTFKGKLGEKNAKAAEVAYNEMLKKYG
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaattagatttcacggaagaggaggacaaggagctgttacagcagcacaaatt
ttagctaaagctgctttttatgatggaaagttttgtcaagcatttccattctttggtgtt
gagagaagaggggctccagttatggcattcacaagaatagacgataagaagataacatta
agatgccaaatctatgagccagattatgttattgttcaggatgctactcttttagagagt
gttaatgttgttgaggggttaaagaaagatggcgctgttgtaattaacactgttaaggat
gatttagatttaggctacaaaacatatacaattgatgctacaggaatagcgttagatgtt
ttaggagttccaattgtaaatactgcaatggttggagcttttgctggagttacaggaatt
gttagcatagaatcagttaaaaaagctattttagatacatttaaaggtaaattaggagag
aaaaacgctaaagctgctgaagtagcatacaatgagatgttaaaaaaatatggataa

DBGET integrated database retrieval system