KEGG   Methanocaldococcus jannaschii: MJ_0299Help
Entry
MJ_0299           CDS       T00003                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mja00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MJ_0299
   01230 Biosynthesis of amino acids
    MJ_0299
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MJ_0299
   00030 Pentose phosphate pathway
    MJ_0299
   00051 Fructose and mannose metabolism
    MJ_0299
  Energy metabolism
   00680 Methane metabolism
    MJ_0299
Enzymes [BR:mja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     MJ_0299
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     MJ_0299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(281755..282924)
Genome map
AA seq 389 aa AA seqDB search
MSRMENNKVTISVIKADVGGLCGHTLAPDELLEACEAVLEEAVDEIILDYYVTRCGDDID
LIMSHKLGCDNEKVHGLAWRAFEEATKVAKELKLYGAGQDLLADSFSGNVRGMGPGCAEM
EFVERKSEPIVVFCCDKTDPTAFNYPLFKMFADPFNTAGLVFDPSMISGFKFEVHDVVGH
KKVFLDTPEEMYMLLALIGDYEKYAIKRVYRRRDNEIAAVVSTEKLNYIAGEYVGKDDPV
AIVRAQSGFPAVGEVLEPFANPHFVPGWMRGSHWGPLMPVGEEDATPTRFDGPARIIALG
FQVCDGMLIGPNDLFADKGFDKAREKALEMADIIRRMGPFQPHRLPATMMEYTTVPKVLE
ALEDRFIPLEGLELIEEGGITRKDRGDVE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagaatggaaaacaacaaagtaacaatcagtgttataaaggcagatgttggaggt
ttatgtgggcacacattagctccagatgagttgttggaggcatgtgaggcagttttagag
gaggcagttgatgagattatattagattattatgtcacaagatgtggggatgacattgat
ttaattatgagccataaattaggttgtgataatgaaaaagtccatggattagcatggagg
gcttttgaggaggcaacaaaagtagctaaagagttaaagttatatggagctggacaggat
ttattagctgacagcttttcaggaaacgttagaggtatggggcctggttgtgcagagatg
gagtttgttgagagaaagagtgagccaatagttgttttctgttgcgacaaaacagaccca
acagcatttaactacccattattcaagatgtttgcagacccattcaacacagctggtttg
gtctttgacccatcaatgatttctggattcaaatttgaggttcatgatgtcgttggacac
aaaaaggtctttttagacactccagaagaaatgtatatgctcttagctttaattggagat
tatgagaagtatgcaattaagagagtttatagaagaagagataacgaaatagctgctgtt
gttagcacagaaaaattaaactacatagctggggagtacgttggtaaagatgacccagta
gctattgttagagctcagagcggattcccagcagttggagaggttttagagccatttgcc
aacccacacttcgttccaggatggatgagaggtagccattgggggccgttaatgccagtt
ggagaggaggatgcaacacctacaagattcgatgggccagcaagaattattgccttagga
ttccaagtttgtgatggaatgttaatcggtcctaacgatttgtttgcagataaaggattc
gataaagcaagagagaaagctttagagatggcagatattataagaagaatgggtccattc
caaccacacagattgcctgcaacaatgatggaatacacaacagttccaaaggtcttagag
gcattggaggatagatttattcctttagaaggtttagagttgattgaagaaggaggaatc
acaagaaaagacagaggagatgtggaataa

DBGET integrated database retrieval system