KEGG   Methanocaldococcus jannaschii: MJ_0309Help
Entry
MJ_0309           CDS       T00003                                 

Definition
agmatinase SpeB
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:mja00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MJ_0309
Enzymes [BR:mja01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     MJ_0309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(289278..290132)
Genome map
AA seq 284 aa AA seqDB search
MEEHFIDLSKFMMANCPYEEAEGVIFSIPYDETTSFKPGAREGGNAIRTASWGLETYSPI
LDRDLAELKYCDLKDLDLYGSQEEIFGTIHSVSREILKENKKIIVFGGEHSITYPIIKAV
KDIYDDFIVIQFDAHCDLRDEYLGNKLSHACVMRRVYELTKNIFQFGIRSGDKEEWDLAR
KNNLYLKMDLMNKDDLEYIKSLDKPIYVTIDIDVLDPAYAPGTGTPEPCGFSTRELFNSL
YLLEEVKDKIIGFDIVEVSPIYDIANITAITAAKIARELMLMIL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggaggagcactttattgatttatctaaatttatgatggcaaattgtccttatgaagaa
gctgagggagttatattttcaattccctatgatgaaacaacctcatttaaaccgggagcg
agagagggaggaaacgctataagaacagcatcatggggtttagaaacatacagcccaatt
ttagatagagatttggcagaattaaaatactgtgatttaaaagatttagatttgtatgga
agtcaagaagaaatatttggcacaattcactcagtctcaagggaaatattaaaagaaaat
aaaaaaatcattgtttttggaggagagcattctataacttatccaataatcaaagctgta
aaagacatctatgatgattttattgttattcaatttgatgcccattgtgatttgagagat
gaatatttgggtaataagctctctcatgcgtgtgttatgaggagagtttatgagctaacc
aaaaatatattccaatttggaattagaagtggagataaagaggaatgggaccttgcaagg
aaaaacaacctctatctaaagatggatctaatgaataaggatgatttagaatatataaag
agcttagacaagccaatatatgtaactatagatatcgatgtgttagaccctgcctatgct
ccaggaactggaactccagaaccctgtggattttcaacaagagaactttttaactcttta
tatttattagaagaggttaaagataaaattattggttttgatatagttgaagtttctccg
atttatgatattgccaatattacagcaataaccgctgctaaaatagcaagagaacttatg
ttgatgattctataa

DBGET integrated database retrieval system