KEGG   Methanocaldococcus jannaschii: MJ_0457Help
Entry
MJ_0457           CDS       T00003                                 

Definition
diaminopimelate aminotransferase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mja01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mja00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
407953..409185
Genome map
AA seq 410 aa AA seqDB search
MDLIEEAIKLESDLIRINSVNPSFGGKGEKEKAEYVKKKLMEYVESYNIENYTLKEYNII
DKYGIERPNIVFKIDFGRDKTLHIISHLDTVPEGDISLWGTNPYEPVIKDGKIYGRGSED
NHKGIVSSLLLLKMIFENNIEPKYNLSLIFVSDEEDGSEYGLKYLLNNFEDEIFKKDDLI
IVPDFGTPTGEFVEIGEKGILWIKFNIKGKQCHGSTPENGLNADIVAFNFANELYNGLYE
KFDEINSIFLPEYSTFEPTILKNKVENPNTIPGYVEVVFDCRILPTYKIEEVLEFINKFI
KNFEFKKYIKHYDNSIKAEITYEILKSENPNYTDENAEIIKELKKAIKNVLNRDAKLCGM
GGGTVAAFLRYKGYNVAVWGIGEETAHQPNEHIKIEDLVKMAEVFYEILK
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggatttaatagaagaagctataaagttagagagtgatttaataagaataaattcagta
aatccttcatttggtggaaaaggagaaaaagaaaaggcagaatacgtcaagaaaaagtta
atggaatacgttgaaagctacaatatagaaaattacactttaaaggaatataacatcata
gataaatatggtattgagaggccaaatattgtatttaaaatagattttggaagagataag
acattacatattatttctcatttagatactgttccagagggggatattagtttatggggc
acaaatccttatgagccagttattaaagatggaaaaatttatggaaggggaagtgaggac
aaccataaggggattgtttcctctctattattattaaaaatgatttttgaaaataatatt
gagccaaaatacaacttatcattaatttttgtctctgatgaagaagatggaagtgaatat
ggcttaaaatatctattgaataactttgaagatgagatatttaaaaaggatgatttaatc
atagttcctgactttggaacaccaactggagaatttgtagagattggagagaagggaatt
ctgtggataaaatttaacattaaaggaaagcaatgtcatggtagcacaccagaaaatggg
ttgaatgctgatatagtggcttttaactttgcaaatgagttatataatggtttatatgag
aaatttgatgaaattaattcaatattcctcccagagtattcaacctttgaaccaacgata
ttaaaaaataaagttgaaaatccaaacaccattcctggatatgtagaggttgtttttgat
tgtagaattttgccaacttacaaaatagaggaagttttggagtttataaataagtttatc
aaaaactttgagtttaaaaaatatattaagcattatgataactcaataaaggcagagata
acttatgaaatattaaaatctgaaaatccaaattacacagatgaaaacgctgaaattatc
aaagaattgaaaaaagctataaagaatgttttgaatagagatgctaagctttgcggaatg
ggtgggggaactgttgcggcatttttgagatataagggctataatgtagcagtttggggc
attggagaagagactgcccaccaaccaaatgagcatattaaaatagaggatttggttaag
atggctgaagtgttttatgaaattttgaaatag

DBGET integrated database retrieval system