KEGG   Methanocaldococcus jannaschii: MJ_0457Help
Entry
MJ_0457           CDS       T00003                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase (dapE)
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mja  Methanocaldococcus jannaschii
Pathway
mja00300  Lysine biosynthesis
mja01100  Metabolic pathways
mja01120  Microbial metabolism in diverse environments
mja01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mja00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    MJ_0457
Enzymes [BR:mja01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     MJ_0457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AAB98445
UniProt: Q57899
Position
407953..409185
Genome map
AA seq 410 aa AA seqDB search
MDLIEEAIKLESDLIRINSVNPSFGGKGEKEKAEYVKKKLMEYVESYNIENYTLKEYNII
DKYGIERPNIVFKIDFGRDKTLHIISHLDTVPEGDISLWGTNPYEPVIKDGKIYGRGSED
NHKGIVSSLLLLKMIFENNIEPKYNLSLIFVSDEEDGSEYGLKYLLNNFEDEIFKKDDLI
IVPDFGTPTGEFVEIGEKGILWIKFNIKGKQCHGSTPENGLNADIVAFNFANELYNGLYE
KFDEINSIFLPEYSTFEPTILKNKVENPNTIPGYVEVVFDCRILPTYKIEEVLEFINKFI
KNFEFKKYIKHYDNSIKAEITYEILKSENPNYTDENAEIIKELKKAIKNVLNRDAKLCGM
GGGTVAAFLRYKGYNVAVWGIGEETAHQPNEHIKIEDLVKMAEVFYEILK
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggatttaatagaagaagctataaagttagagagtgatttaataagaataaattcagta
aatccttcatttggtggaaaaggagaaaaagaaaaggcagaatacgtcaagaaaaagtta
atggaatacgttgaaagctacaatatagaaaattacactttaaaggaatataacatcata
gataaatatggtattgagaggccaaatattgtatttaaaatagattttggaagagataag
acattacatattatttctcatttagatactgttccagagggggatattagtttatggggc
acaaatccttatgagccagttattaaagatggaaaaatttatggaaggggaagtgaggac
aaccataaggggattgtttcctctctattattattaaaaatgatttttgaaaataatatt
gagccaaaatacaacttatcattaatttttgtctctgatgaagaagatggaagtgaatat
ggcttaaaatatctattgaataactttgaagatgagatatttaaaaaggatgatttaatc
atagttcctgactttggaacaccaactggagaatttgtagagattggagagaagggaatt
ctgtggataaaatttaacattaaaggaaagcaatgtcatggtagcacaccagaaaatggg
ttgaatgctgatatagtggcttttaactttgcaaatgagttatataatggtttatatgag
aaatttgatgaaattaattcaatattcctcccagagtattcaacctttgaaccaacgata
ttaaaaaataaagttgaaaatccaaacaccattcctggatatgtagaggttgtttttgat
tgtagaattttgccaacttacaaaatagaggaagttttggagtttataaataagtttatc
aaaaactttgagtttaaaaaatatattaagcattatgataactcaataaaggcagagata
acttatgaaatattaaaatctgaaaatccaaattacacagatgaaaacgctgaaattatc
aaagaattgaaaaaagctataaagaatgttttgaatagagatgctaagctttgcggaatg
ggtgggggaactgttgcggcatttttgagatataagggctataatgtagcagtttggggc
attggagaagagactgcccaccaaccaaatgagcatattaaaatagaggatttggttaag
atggctgaagtgttttatgaaattttgaaatag

DBGET integrated database retrieval system