KEGG   Methanocaldococcus jannaschii: MJ_0555Help
Entry
MJ_0555           CDS       T00003                                 

Definition
endoglucanase CelM
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mja00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MJ_0555
Enzymes [BR:mja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MJ_0555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
490782..491834
Genome map
AA seq 350 aa AA seqDB search
MSVVEYLKKLSKLHGISGREDSVREFMKKELEKYCDSVEIDNFGNLIAKRGNKGKKIMIA
AHMDEIGLMVKYIDDNGFLKFTKIGGIYDPTILNQKVVVHGSKGDLIGVLGSKPPHRMKE
EEKTKIIKYEDMFIDIGAESREEAIEMGVNIGTWVSFLSEVYDLGKNRLTGKAFDDRVGC
AVLLEVMKRLSEEDIDCQVYAVGTVQEEVGLKGARVSAFKINPDVAIALDVTIAGDHPGI
KKEDAPVDLGKGPVVGIVDASGRGLIAHPKVLDMIKAVSEKYKIDVQWEVGEGGTTDATA
IHLTREGIPTGVISVPARYIHTPVEVIDKRDLEKTVELVYNCIKEVNNFF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttgttgaatacttaaaaaagctctcaaaactacatggaatatctgggagggag
gatagtgttagagagtttatgaaaaaagagttggaaaaatactgtgattccgttgaaatt
gataactttgggaatttaatagcaaagagagggaataaaggaaagaagattatgatagca
gctcacatggatgagattggtttgatggttaaatatattgacgataatggtttcttaaaa
ttcacaaagattggaggcatttatgacccaacaatattaaaccaaaaggttgttgttcat
ggaagtaaaggggatttaattggtgttttaggctcaaaacctccacacagaatgaaagaa
gaagaaaaaaccaaaataattaaatatgaagatatgtttatagacattggagctgagagt
agggaagaggctatagaaatgggggttaatataggaacatgggtttcttttttaagtgag
gtttatgatttaggtaaaaatagattaactggaaaggcatttgatgatagggtgggatgt
gctgttctcttagaagttatgaaaaggttatctgaagaagatattgactgtcaggtctat
gcagtgggaactgtccaagaggaagttggattaaaaggggcaagagtctctgcctttaaa
ataaatccagatgttgccattgcgttagatgttactatagcaggagaccatccaggaatt
aaaaaagaagatgctccggtagatttaggtaaggggccagtggttggaatagtagatgca
tctggtagagggttgatagctcatccaaaagtcttagatatgattaaagctgtttctgaa
aagtataaaatagatgttcagtgggaagttggtgagggaggaactacagatgcaacagcc
attcatttaacaagagagggaattccaactggtgttatctctgttccagcaagatatata
catactccagttgaagttattgataagagagatttagaaaaaactgtggaattggtttat
aattgcataaaagaggtcaataatttcttctaa

DBGET integrated database retrieval system