KEGG   Methanocaldococcus jannaschii: MJ_0555Help
Entry
MJ_0555           CDS       T00003                                 

Definition
(GenBank) endoglucanase (celM)
Organism
mja  Methanocaldococcus jannaschii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
490782..491834
Genome map
AA seq 350 aa AA seqDB search
MSVVEYLKKLSKLHGISGREDSVREFMKKELEKYCDSVEIDNFGNLIAKRGNKGKKIMIA
AHMDEIGLMVKYIDDNGFLKFTKIGGIYDPTILNQKVVVHGSKGDLIGVLGSKPPHRMKE
EEKTKIIKYEDMFIDIGAESREEAIEMGVNIGTWVSFLSEVYDLGKNRLTGKAFDDRVGC
AVLLEVMKRLSEEDIDCQVYAVGTVQEEVGLKGARVSAFKINPDVAIALDVTIAGDHPGI
KKEDAPVDLGKGPVVGIVDASGRGLIAHPKVLDMIKAVSEKYKIDVQWEVGEGGTTDATA
IHLTREGIPTGVISVPARYIHTPVEVIDKRDLEKTVELVYNCIKEVNNFF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttgttgaatacttaaaaaagctctcaaaactacatggaatatctgggagggag
gatagtgttagagagtttatgaaaaaagagttggaaaaatactgtgattccgttgaaatt
gataactttgggaatttaatagcaaagagagggaataaaggaaagaagattatgatagca
gctcacatggatgagattggtttgatggttaaatatattgacgataatggtttcttaaaa
ttcacaaagattggaggcatttatgacccaacaatattaaaccaaaaggttgttgttcat
ggaagtaaaggggatttaattggtgttttaggctcaaaacctccacacagaatgaaagaa
gaagaaaaaaccaaaataattaaatatgaagatatgtttatagacattggagctgagagt
agggaagaggctatagaaatgggggttaatataggaacatgggtttcttttttaagtgag
gtttatgatttaggtaaaaatagattaactggaaaggcatttgatgatagggtgggatgt
gctgttctcttagaagttatgaaaaggttatctgaagaagatattgactgtcaggtctat
gcagtgggaactgtccaagaggaagttggattaaaaggggcaagagtctctgcctttaaa
ataaatccagatgttgccattgcgttagatgttactatagcaggagaccatccaggaatt
aaaaaagaagatgctccggtagatttaggtaaggggccagtggttggaatagtagatgca
tctggtagagggttgatagctcatccaaaagtcttagatatgattaaagctgtttctgaa
aagtataaaatagatgttcagtgggaagttggtgagggaggaactacagatgcaacagcc
attcatttaacaagagagggaattccaactggtgttatctctgttccagcaagatatata
catactccagttgaagttattgataagagagatttagaaaaaactgtggaattggtttat
aattgcataaaagaggtcaataatttcttctaa

DBGET integrated database retrieval system