KEGG   Methanocaldococcus jannaschii: MJ_0620Help
Entry
MJ_0620           CDS       T00003                                 

Definition
30S ribosomal protein S6 modification protein RimK
Orthology
K15740  
tetrahydromethanopterin:alpha-L-glutamate ligase [EC:6.3.2.33]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:mja00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MJ_0620
Enzymes [BR:mja01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.33  tetrahydrosarcinapterin synthase
     MJ_0620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
549689..550564
Genome map
AA seq 291 aa AA seqDB search
MKLGIITIERDAVVNDLIKSCEKYEVDYKVITPSNIVAGFNLDFKLKYYKSFLDELDCCF
VRNLGWDSFFRFDVLKYLNHYIPVINPPDGIDRASNKFLTSVFLELNNLPQPKTVVTESI
NEAIVWIDKFEEAVLKPIFGCGGEGIVRVKKELPISTKLKILNEFKEKYNTFYIQEFIKP
VRNEHRDIRAFVVDDEVVAAMYRIGGENWKNNVSQGGRVEKCEITEEIEKLALKAKNALG
LFYAGVDLIESEDGLKVLEVNSTPSWIGLSKVSEVNIADKLLEKIIQYVKS
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttggtataattaccatagaaagagatgctgtagtcaatgatttaataaaatcc
tgtgaaaagtatgaagtagattataaagttataaccccttcaaatattgtagctggattt
aatttggattttaaattaaaatattacaagtcatttttagatgaattagattgctgtttt
gttagaaatcttggctgggatagtttttttagatttgatgtcttaaagtatttaaatcat
tatattcccgttataaatcctccagatggaatagatagggcatcaaataagtttttaacc
tctgtatttcttgaattaaataatctcccacaaccaaagactgttgttactgaaagtata
aatgaagcaattgtctggatagataaatttgaagaagcagttttaaaaccaatatttgga
tgtggtggggagggaattgttagggttaaaaaagaactgccaatatctactaagttaaag
attttaaatgaatttaaagaaaaatataataccttctatatccaggaatttataaaacca
gtaagaaatgaacatagagatataagggcttttgtagttgatgatgaggtcgttgcggca
atgtataggattggaggagaaaattggaaaaacaatgtttctcagggaggaagagttgag
aaatgtgaaataactgaagaaattgaaaaattggctttaaaagcaaaaaatgctcttggt
ttattttatgctggagttgatttaattgagtcagaagatggtttaaaagttttagaagta
aattcaacaccatcttggattggattatctaaggtctctgaggttaatatagccgataaa
ctcttagaaaaaataattcaatatgttaaatcttaa

DBGET integrated database retrieval system