KEGG   Methanocaldococcus jannaschii: MJ_0643Help
Entry
MJ_0643           CDS       T00003                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mja00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MJ_0643
Enzymes [BR:mja01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     MJ_0643
Exosome [BR:mja04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MJ_0643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
572446..573453
Genome map
AA seq 335 aa AA seqDB search
MFKINLGDFMLIRPRRLRKNQKIRDLVRETILTKNDLIMPIFVDENLKGNEKKEISSMPN
QYRFSVEGAIEEAKEIADLGIPAVILFGIPKHKDEIASSAYDKNGVVQRTIRGIKEELGD
ELLVIADCCLCEYTSHGHCGIVKDGKILNDATLPILAKIALSYADAGVDIVAPSDMMDGR
VRAIREILEENGYDDVAIMSYSAKYASSFYGPFREAAESAPKFGDRKSYQMDIGNAREAL
KEIALDIEEGADLILVKPALPYLDIIRMAKDRFDVPIGGYCVSGEYAMVEAAARNGWLDR
EKVIYEILLSIKRAGADFIITYWAKEVAEIGLSQE
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaaaataaatttgggtgattttatgctgataaggccaagaagattaagaaaaaac
caaaaaattagagatttagttagagaaactatattaacaaaaaatgacttaattatgcca
atttttgtagatgaaaatttaaaagggaatgagaagaaggagattagctcaatgcctaat
cagtataggtttagtgtggaaggggctatagaagaagcaaaagaaatagctgatttaggc
attccagctgtaatattatttggtattccaaagcataaggatgagatagcaagctctgcc
tacgataaaaatggagttgttcaaagaactataaggggaattaaagaagagttaggggat
gagcttttagttattgccgattgttgtttatgcgaatacacaagccatggacactgtgga
atagttaaagatggaaagattttgaacgatgccacactcccaatattggcaaagatagct
ttatcctatgcagatgctggtgttgatattgtcgctccttcagacatgatggatggaaga
gttagggctataagggagattttagaagaaaatggatatgatgatgttgctataatgagt
tactcagctaaatatgcctcatcattttacggcccgtttagagaagcggctgaaagtgcc
cctaaatttggagataggaagagttatcagatggacataggaaacgcaagagaggcttta
aaagaaattgcattggatatagaggagggtgctgatttaattttggttaagccagctttg
ccttatttggatataataaggatggctaaggacaggtttgatgtgcctattggtggatac
tgcgttagcggagagtatgcaatggttgaagcagcagcaagaaatggatggttagataga
gaaaaagtaatttatgaaatactgttaagtataaaaagggctggagctgattttattata
acatattgggctaaggaggttgctgaaataggactttcacaggaataa

DBGET integrated database retrieval system