KEGG   Methanocaldococcus jannaschii: MJ_0667Help
Entry
MJ_0667           CDS       T00003                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mja00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MJ_0667
Enzymes [BR:mja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MJ_0667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
592702..594213
Genome map
AA seq 503 aa AA seqDB search
MLFLKVRVLDIDLENLVLINSEDLKSSQYFPQDRVVVEFKGKEVIGILHSSTTLINRGEI
GLPQKVVKELGVKEGDIVTIKHAEKPKSLPYIRKKMDGNKLKKEEIFEIIDEMVDGKLTN
IEISAFVTSLYINGMDMDEIEAMTIRMAETGEMVNWEGHIFDVHSIGGVPGNKYALLVVP
IVASAGLKIPKTSSRAITSAAGTADVVEVLTRVDLTIEEIKRVVKETNGCMVWGGALDLA
PADDITINVERPLGIDPEPLLLSSVMAKKLAMGVNKLLIDIPTGYGAKVKSIKEASSLAR
KFIELSDRLRIVTECAITYGGQPIGRAIGPALEAKEALLALEDYTQAPTSLVEKSISLAG
ILLEMGGVAPTGEGKELAEDLLARGKAHDKFMEIIVAQGGKEVSSDEIEVGKYKADIHSP
IDGYVTRISNAGITKIAKEAGAPNDKKAGIYLNVKVGNKVEKGDVLYTIYSDSEERLKSA
IKLARILYPIKVEGMLLQKISRF
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgctatttctaaaagttagagttttagatattgacttggagaatttggttttaattaat
tctgaagacttaaaaagctctcagtatttccctcaagatagagtagttgtggagtttaaa
ggaaaagaagttattggaatcctacattcttcaaccacattgataaacagaggagaaata
gggcttccacaaaaagtagttaaagagttaggtgttaaagaaggggatattgttacaata
aaacatgctgaaaaacctaaatctctcccatatataagaaaaaagatggatggaaataaa
ttaaaaaaagaggaaatttttgaaattatagatgagatggtggatggaaagctaacaaat
attgaaatatctgcctttgtcacctcattatatataaatggaatggatatggatgagatt
gaagcaatgacaattagaatggctgaaactggagagatggttaattgggaggggcatata
tttgacgtgcattcaattggaggagttcctggaaacaaatatgctttattagtcgtgcca
atagttgcctctgctggcttaaagattccaaaaacatcttcaagggcaataacttcagcg
gcaggaacagcagatgttgttgaagttttaacaagagtggatttaaccattgaagaaata
aaaagagttgttaaagaaacaaacggttgtatggtatggggaggggctttagatttagct
cctgcagatgatataacaataaatgttgaaagacctcttggcatagacccagagccctta
ttattatcaagtgtcatggcaaaaaaattagctatgggtgttaataagctattgattgat
attccaacaggatatggagcaaaagttaaatctataaaagaggcatcaagcttagcaagg
aagtttattgaattgagtgatagattgaggatagttactgaatgtgctataacttacgga
ggacagccaattggaagagctattggtccagctttagaagcaaaagaggcattattggct
ttggaagattatactcaagcccctacaagccttgttgagaaatctatttcattagctgga
attttgttagagatgggaggagtagctcctactggagaaggtaaagagttagctgaagat
ttattagcaagagggaaggcacatgacaaatttatggagattattgtagctcagggagga
aaagaagttagttcagatgaaattgaggttggaaaatataaagctgatattcactcacca
attgatgggtatgttacaagaatatcaaatgctggaattacaaaaattgccaaagaagct
ggagctccaaatgataaaaaagctggtatctatctaaacgtaaaagtaggaaataaagtt
gaaaaaggagatgttttatacaccatatactctgactctgaagaaaggctaaaatcagct
attaaattagcaagaatattgtatccaatcaaagttgagggcatgttactccaaaaaatt
tcaagattctaa

DBGET integrated database retrieval system