KEGG   Methanocaldococcus jannaschii: MJ_0768Help
Entry
MJ_0768           CDS       T00003                                 

Definition
F420-0--gamma-glutamyl ligase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Module
F420 biosynthesis
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:mja00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
689588..690337
Genome map
AA seq 249 aa AA seqDB search
MIKEKRKVEVIGLELPIFKGGEQINLSELIAQYPIEDGDIIVIAETLISKLEGGVIDRDK
IIPSKEAIELAKKTGKDPKVVQVILDEAKEIVKVGKNFIITETKHGFVCANSGVDESNIY
KGIKILPKNPDESAEKIRKEIEKLTGKRVGVIISDSVGRPFRKGAVGIAIGVSGILALWD
RKGEKDLFGRELKTTEVAIADELASMANVVMGEADEGIPVVIIRGANVPFGNGKGRDLIR
PKEEDVFRN
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagaaaaaagaaaggtagaggttattggcttagaactcccaatttttaaaggt
ggagaacaaataaatttatctgagttgatagctcaatacccaattgaagatggagatatt
attgtaatagcagaaacattaatctcaaaattagagggtggagttatagatagggataaa
ataatcccttcaaaagaagcaattgaattagccaaaaaaactggaaaagacccgaaggtt
gtgcaagttatattagatgaggctaaagaaatagttaaggttggaaagaacttcattata
acagaaaccaaacatggatttgtttgtgctaacagtggagttgatgaaagtaacatatac
aaaggcataaaaattctaccaaaaaatccagatgaaagtgctgaaaagattaggaaagag
attgaaaaattaactggaaagagagttggagtaataatatcagatagtgttggaagacct
ttcaggaagggagctgttggaatagcaataggagttagtggaatcttagcattatgggat
aggaagggggaaaaggatttgtttggtagggagttaaaaacaactgaagttgccattgct
gatgagttggcaagtatggcaaatgtggttatgggagaggctgatgagggcattccagtt
gtaataattaggggggctaatgtgccttttggtaatgggaagggaagagatttaattaga
cctaaggaggaagatgtttttagaaattaa

DBGET integrated database retrieval system