KEGG   Methanocaldococcus jannaschii: MJ_0910Help
Entry
MJ_0910           CDS       T00003                                 

Definition
magnesium chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mja00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(841429..841953)
Genome map
AA seq 174 aa AA seqDB search
MGAMRRMEAAKGAIISLLLDAYQKRNKIGMIAFRKDKAELILPFTSSVELGEKLLKDLPT
GGKTPLADAFIKSYEVFDREIRKNPNIIPIMIVISDFKPNVAVKEDYVKEVFDACEKIAE
KGINVILIDTEPQSFIKIGIGKEIANRFGFKYYKIEELSKDKILDICKSLEINF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgggagcaatgagaagaatggaagctgctaagggggctataatctctctacttttagat
gcatatcaaaagaggaataaaattggaatgattgcatttagaaaggataaagctgagtta
atcttgccattcacatcttcagtagagttgggagagaaactattaaaagatttaccaact
ggaggaaaaacacctttagctgatgcctttattaagagttatgaggtctttgatagagag
attagaaaaaatccaaatattatcccaataatgattgtaattagcgatttcaaaccaaat
gtagctgttaaggaggattatgttaaagaggtttttgatgcatgtgagaagatagctgaa
aagggcattaacgttatattaattgatacagaaccacaatcatttataaagattgggatt
ggaaaggagatcgctaatagatttggatttaagtattacaaaatagaagagttaagcaaa
gataaaatcttagatatttgtaagagtttagaaattaacttctaa

DBGET integrated database retrieval system