KEGG   Methanocaldococcus jannaschii: MJ_0911Help
Entry
MJ_0911           CDS       T00003                                 

Definition
magnesium-chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mja00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MJ_0911
Enzymes [BR:mja01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MJ_0911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(842385..843482)
Genome map
AA seq 365 aa AA seqDB search
MMIMQYIYPFTAIVGQEKMKKALILNAINPKIGGVLIRGEKGTAKSTAVRALADLLPEIE
IVEGCPFNCDPNGNLCDICKEKKKRGELKTTKKKMKVVNLPIGATEDRVIGTLDIEKAIK
EGIKALEPGILAEANRNILYIDEVNLLDDHIIDVLLDAAAMGWNIIEREGVKIKHPSRFI
LVGTMNPEEGELRPQILDRFGLMVDVEGLNDVKDRVEVIKRVEEFNENPEAFYKKFEEEQ
NKLRERIIKARELLNKVEISDDLLEFISKVCIELGIQTNRADITVVRTAKALAAYNGRTY
VTIDDVKEAMELALPHRMRRKPFEPPQLNKEKLEQMINEFKQQNNKDNEEKEEHKDDDVK
KNMMK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgatgattatgcagtatatttacccatttacagcaatagttggacaggaaaagatgaaa
aaagcattgatcttaaatgcaataaatccaaagattggtggtgtcttaattagaggagag
aaagggacagcgaaatctacagcagttagggctttggctgatttactcccagagattgaa
attgttgaaggatgtccattcaactgcgacccaaatggaaacctatgtgatatttgcaaa
gaaaagaaaaagagaggagagttaaaaactacaaaaaagaagatgaaagtagttaatctc
ccaattggagctactgaagatagggttatcggaacattggatatagagaaggcaataaaa
gaaggaattaaagcattagagccaggaattttagcagaggcaaatagaaatatcctatac
attgatgaagttaatttactggatgaccatataattgatgttttgttggatgctgcagca
atgggttggaatatcattgagagagaaggagttaagataaagcatccttcaagatttata
ttagtagggactatgaacccagaggagggagagttgagacctcaaatcttagatagattt
ggtttaatggttgatgttgaaggattaaatgatgttaaagatagggtagaggttataaag
agagttgaggaattcaacgaaaatccagaggcattttataagaaatttgaggaagagcag
aacaaattaagagagaggataattaaagcaagagagcttttaaataaagttgagataagt
gatgacctcttagaatttatatctaaagtttgtattgagttaggaattcagacaaataga
gcagatataaccgttgttagaacagctaaggcgttagctgcttacaatggacgaacttat
gtaactatagatgatgttaaagaggctatggagttggctctaccacatagaatgagaaga
aagccatttgaacctccacaactaaataaagagaagttggagcagatgattaatgaattt
aaacagcaaaataataaagataatgaagagaaagaagagcataaagatgatgacgtaaaa
aaaaacatgatgaaataa

DBGET integrated database retrieval system