KEGG   Methanocaldococcus jannaschii: MJ_0994Help
Entry
MJ_0994           CDS       T00003                                 

Definition
uroporphyrinogen III synthase HemD
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mja00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(922913..923635)
Genome map
AA seq 240 aa AA seqDB search
MKVVITRPKERADVFASLLKKEGFEPIIFPTLEIVYNKDLDVNLDSYDWIAFTSPSGVIG
LYNILTENERENVKNKKIAVIGEKTAKTFKKYFGRDPDIMPNEYTAESLLREIKKVSKEE
EKFLIPTTPSTRDVLKNNLNADLLFVYKSAEPENLKEDIKKLKELIAKDKFILTFTSGLT
AKNFFKYVDDEFAEIIKDNYIVAIGPITAKVIEKFGFKPLIPKVYTIEGMLEVIRTLKER
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgtgataacgagacctaaggaaagggctgatgtttttgccagtttattaaaa
aaagaagggtttgaaccaataatatttccaacattggagattgtatataataaagattta
gatgttaatttagacagctatgattggatagcttttacctcaccaagtggtgttattgga
ctatacaatatactaactgaaaatgaaagagaaaatgtaaaaaataaaaaaattgcagtt
attggagaaaaaacagcaaaaacttttaaaaaatattttggtagggacccagatataatg
cctaatgaatacactgcagagtccctcctaagagagattaaaaaagtttctaaagaggag
gaaaaatttttaatcccaacaacaccatcaacaagagacgttttaaagaataacttaaat
gctgatttgttatttgtgtataaatcagcagagccagaaaacttaaaagaggatattaaa
aaactaaaagagttaatagcaaaagataaatttattctaacatttacaagtggattaaca
gctaagaatttttttaagtatgtggatgatgagtttgctgaaattataaaagataactac
atagtcgccattggtcctataactgccaaagttattgaaaaatttggttttaaaccatta
attcctaaagtatatacgattgaagggatgttagaagttattagaacattaaaggagagg
tag

DBGET integrated database retrieval system