KEGG   Methanocaldococcus jannaschii: MJ_1037Help
Entry
MJ_1037           CDS       T00003                                 

Definition
(GenBank) tryptophan synthase beta subunit (trpB)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mja00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MJ_1037
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MJ_1037
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MJ_1037
Enzymes [BR:mja01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MJ_1037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
968341..969555
Genome map
AA seq 404 aa AA seqDB search
MSILKKYKDMYPDENGKFGIYGGKFVPETLMPAIAELEEAFKRFWINNEGNFREEFYALL
RDYVGRPTPLYYAERLSEELGCKVYLKREDLAHLGAHKINNALGQALLAKKMGKKRVIAE
TGAGQHGVATAAACAKLGLECIIYMGAKDVERQKLNVFRMELMGAKVIPVFGGSQTLKDA
VNEALRDWTTNVRTTYYLLGSALGPHPYPMMVREFQRVIGKELKEQILEKEGRLPDVIVA
CVGGGSNAIGAFYEFLDDDVELYAVEAGGKGIETGMHGASLCAGEVGVLHGAKIYVKEDE
FGQIEESYSISAGLDYPGVGPELSFLKDEGRIKAVCVTDDEALEAFQLLCRLEGILPALE
SSHALAYAVKLADKLDKDDIMVINLSGRGDKDVQTVAKALGREI
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgtccatcttgaagaaatacaaagacatgtatccagatgaaaatggaaagtttggcatt
tacggaggtaaatttgttccagaaacattgatgccagccatagctgaattggaagaagca
tttaagagattttggataaacaatgaaggaaactttagagaagagttctatgctttattg
agggattacgttggaagaccaacaccattatattatgctgagagattgagtgaagaactt
ggttgtaaagtttatttaaagagagaagatttagcacacttaggagctcataaaataaac
aacgccttaggacaagctttgttagctaaaaagatgggtaaaaagagagttatagctgaa
actggagctggacagcatggagttgctactgcagcagcatgtgcaaagcttggattagaa
tgcataatatacatgggagctaaagacgttgaaaggcaaaaattaaatgtttttaggatg
gagttgatgggagctaaggttattccagtatttggaggctcacagacattaaaagatgct
gtaaatgaagctttgagagattggacaaccaacgttagaactacctactatttgcttggt
tctgccttaggacctcatccatacccaatgatggttagagaattccaaagagttattggt
aaagaacttaaagagcagatattagaaaaagagggaagattgccagatgttatcgttgca
tgtgttggaggaggaagtaatgcaataggggcattttatgagtttttggatgatgacgta
gagctttacgctgttgaggctggaggtaaagggatagaaactggaatgcatggagcttca
ttatgtgctggagaggttggagttttgcatggagctaagatttatgttaaagaggatgag
tttgggcagatagaagaaagttacagtatttcagcaggtttagattatcctggagtagga
cctgagctttcatttttaaaggatgagggaaggattaaagcagtttgtgtaactgatgac
gaagctttagaggcatttcaattgctatgtaggttagaaggtattttaccagcattggaa
agttctcatgccttagcttatgctgttaaattggctgataaattagataaagatgatata
atggttattaatttgtctggaagaggggataaggacgttcagactgttgctaaggcattg
ggaagggagatttaa

DBGET integrated database retrieval system