KEGG   Methanocaldococcus jannaschii: MJ_1038Help
Entry
MJ_1038           CDS       T00003                                 

Definition
(GenBank) tryptophan synthase alpha subunit (trpA)
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mja  Methanocaldococcus jannaschii
Pathway
mja00260  Glycine, serine and threonine metabolism
mja00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mja01100  Metabolic pathways
mja01110  Biosynthesis of secondary metabolites
mja01130  Biosynthesis of antibiotics
mja01230  Biosynthesis of amino acids
Module
mja_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mja00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MJ_1038
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MJ_1038
Enzymes [BR:mja01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MJ_1038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA Ribul_P_3_epim
Motif
Other DBs
NCBI-ProteinID: AAB99041
UniProt: Q60180
Position
969732..970586
Genome map
AA seq 284 aa AA seqDB search
MEWMIMKLAEKFEELKNKGEKAFVAFYVGGDPNLEISEKALEVICKHADIVEIGIPFSDP
VADGITIQKADVRALNSGMNPLKAFELAKKLNEKAPNVPKVFLTYYNIIFKMGEEEFVKK
CKEAGVSGIIVPDLPIEEADSLYNYCKKYGVDLIFLVAPTTPDERLKKILEKCSGFVYVV
SVTGITGAREKVAEETKELIKRVKKFSKIPACVGFGISKREHVEEITEIADGAIVGSAIV
KIVEKHLDENGQIKDEEKFLKELEEFVKNLKEGTKKKAKVAIKN
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
ttggagtggatgattatgaaattagcagaaaaatttgaagagttaaaaaacaaaggagaa
aaggcatttgttgcattttatgtgggaggagacccaaacttggaaatttcagaaaaggca
ttagaagttatttgtaagcatgctgatattgttgagataggtattccattttctgaccct
gttgcagatggaattacaatacaaaaagcagatgttagagctttaaacagtggcatgaat
ccattgaaggcatttgagttggctaaaaaattgaatgaaaaagctccaaatgttccaaag
gtgttcttaacctactataacataatatttaagatgggagaggaggagttcgttaaaaaa
tgtaaagaggctggagtttctgggattatagttccagatttgccaattgaagaggctgat
agcttatacaattactgtaaaaagtatggagttgatttaatatttttagttgccccaaca
acacctgatgaaaggttaaagaaaattttagaaaagtgtagtgggtttgtttatgttgtt
tctgtaactgggattactggagcgagagagaaagtagctgaagagacgaaagagttaatt
aagagagttaaaaagttttcaaaaatccctgcctgtgtagggtttggaatctcaaagagg
gagcatgttgaggaaataactgaaatagctgatggagctattgtaggaagtgcgattgtt
aagattgttgaaaaacatttagatgagaatggacaaataaaggatgaggaaaaattccta
aaggagttggaggagtttgttaaaaatctaaaggaagggactaaaaagaaggctaaagta
gctataaaaaattaa

DBGET integrated database retrieval system