KEGG   Methanocaldococcus jannaschii: MJ_1038Help
Entry
MJ_1038           CDS       T00003                                 

Definition
tryptophan synthase subunit alpha TrpA
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mja01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mja00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mja00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
969732..970586
Genome map
AA seq 284 aa AA seqDB search
MEWMIMKLAEKFEELKNKGEKAFVAFYVGGDPNLEISEKALEVICKHADIVEIGIPFSDP
VADGITIQKADVRALNSGMNPLKAFELAKKLNEKAPNVPKVFLTYYNIIFKMGEEEFVKK
CKEAGVSGIIVPDLPIEEADSLYNYCKKYGVDLIFLVAPTTPDERLKKILEKCSGFVYVV
SVTGITGAREKVAEETKELIKRVKKFSKIPACVGFGISKREHVEEITEIADGAIVGSAIV
KIVEKHLDENGQIKDEEKFLKELEEFVKNLKEGTKKKAKVAIKN
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
ttggagtggatgattatgaaattagcagaaaaatttgaagagttaaaaaacaaaggagaa
aaggcatttgttgcattttatgtgggaggagacccaaacttggaaatttcagaaaaggca
ttagaagttatttgtaagcatgctgatattgttgagataggtattccattttctgaccct
gttgcagatggaattacaatacaaaaagcagatgttagagctttaaacagtggcatgaat
ccattgaaggcatttgagttggctaaaaaattgaatgaaaaagctccaaatgttccaaag
gtgttcttaacctactataacataatatttaagatgggagaggaggagttcgttaaaaaa
tgtaaagaggctggagtttctgggattatagttccagatttgccaattgaagaggctgat
agcttatacaattactgtaaaaagtatggagttgatttaatatttttagttgccccaaca
acacctgatgaaaggttaaagaaaattttagaaaagtgtagtgggtttgtttatgttgtt
tctgtaactgggattactggagcgagagagaaagtagctgaagagacgaaagagttaatt
aagagagttaaaaagttttcaaaaatccctgcctgtgtagggtttggaatctcaaagagg
gagcatgttgaggaaataactgaaatagctgatggagctattgtaggaagtgcgattgtt
aagattgttgaaaaacatttagatgagaatggacaaataaaggatgaggaaaaattccta
aaggagttggaggagtttgttaaaaatctaaaggaagggactaaaaagaaggctaaagta
gctataaaaaattaa

DBGET integrated database retrieval system