KEGG   Methanocaldococcus jannaschii: MJ_1056Help
Entry
MJ_1056           CDS       T00003                                 

Definition
asparagine synthetase AsnB
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mja00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MJ_1056
Enzymes [BR:mja01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     MJ_1056
Peptidases [BR:mja01002]
 Cysteine Peptidases
  Family C44
   MJ_1056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
994642..996192
Genome map
AA seq 516 aa AA seqDB search
MMCGINGIIRFGKEVIKEEINKMNKAIKHRGPDDEGIFIYNFKNYSIGLGHVRLAILDLS
EKGHQPMGYNVDEDKIIYRDDELDRADIIIVYNGEIYNYLELKEKFNLETETGTDTEVIL
KLYNKLGFDCVKEFNGMWAFCIFDKKKGLIFCSRDRLGVKPFYYYWDGNEFIFSSELKGI
LAVKEINKKENINKDAVELYFALGFIPSPYSIYKNTFKLEARQNLIFDLDKREIRKYYYW
ELPDYKPIYDKKKLIEEGKKLLYDAVKIRMRSDVPVGAFLSGGLDSSTVVGVMREFTDLS
KLHTFSIGFEGKYDETPYIKIVVDYFKTQHHHYYFKERDFEELIDKYSWIYDEPFGDYSG
FPTYKVSEMARKFVTVVLSGDGGDEVFGGYMTHLNGYRMDFIRKLPKFLRVVGSKLPVKK
DLNGIANLYLLKEAFRLSLINPEEFYAESIKEDAIRPEIYKKWTIEKLRYCLNKGDNKLG
EALRIFDLLFNTLCDNFLVKVDRASMLTLWKLEVHF
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgatgtgtgggataaatgggattattagatttggtaaagaagttataaaagaagaaatt
aataagatgaataaagcaattaaacatagaggtcctgatgatgaaggaatctttatttat
aattttaaaaattattctattggtttgggacatgttagattagcaattttagatttaagt
gaaaagggacatcaaccgatggggtataatgttgatgaggataaaatcatttatagagat
gatgagttggatagggcggatataatcattgtttataatggagagatttataattatttg
gagttaaaagaaaaatttaacttagagacagaaacagggacagatacagaggttatttta
aagctttataataagttgggttttgattgtgttaaagagtttaatggtatgtgggcattt
tgtatttttgataaaaagaagggcttaatcttttgttcaagggatagattaggagttaag
ccattttattattattgggatggaaatgaatttatcttttcttctgaattgaagggaatt
ttagcagttaaagagataaataaaaaagaaaatattaacaaagatgcagttgagttatac
tttgccttgggatttatcccatctccctactctatttataaaaacacttttaaattagag
gcaagacagaatttaatctttgatttggataaaagagagattagaaaatattattactgg
gagttgccagattacaaacctatttatgataaaaagaaattgattgaagaaggtaaaaag
ctattatatgatgctgttaagataagaatgaggagtgatgtgccagttggagcgtttttg
agtggtggtttagatagctctacagttgttggagttatgagggaatttacagatttaagt
aaattgcatactttttctataggttttgaaggaaagtatgatgaaactccttatattaag
atagttgttgattactttaaaactcagcatcatcattactactttaaggagagagatttt
gaggaattgattgataaatacagctggatttacgatgaaccgtttggagattatagtgga
ttccctacttataaggtctctgaaatggcaaggaaatttgttactgttgttttgagtgga
gatggcggggatgaggtttttggaggttatatgactcatttaaacggatatagaatggat
ttcattagaaaattacctaaatttttgagagttgttggttctaaattacctgttaagaaa
gatttaaatggaattgctaatttgtatttattaaaggaggcgtttaggttatccttaata
aatccagaggaattctatgctgaatcaataaaagaagatgcgataagaccagaaatttat
aaaaaatggactattgaaaaattaagatattgtttgaataaaggagataataagttgggg
gaagccctaaggatttttgatttattgtttaatactttgtgtgataatttcttagttaag
gttgatagggcatctatgctaacgctttggaagttagaagtccatttttag

DBGET integrated database retrieval system