KEGG   Methanocaldococcus jannaschii: MJ_1116Help
Entry
MJ_1116           CDS       T00003                                 

Definition
asparagine synthetase AsnB
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mja00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1056676..1058310)
Genome map
AA seq 544 aa AA seqDB search
MRDMCSISGIIVKDNQISAKYSIDMMKILKHRGRDNSGLLLDDEVIYFNDFEDVEDLEEE
MIGNLSLAHNRLAIVGRYGVQPIPNEDETIWLVCNGEIYNYIELREYLKQNHEFRTDSDN
EVIIHLYEEEKLEELDGDYAFAIYDKSKNVVRLARDMFGVKPLFYVDRDKYFAFASERKA
LWHLLINIDGCERDLDELNSKIKTLKPNSQLIYYLDDNRFEIIEGFKKLELNYMKERSYE
EAKEYLDRALKNSVLKRVRGLDKVGIICSGGVDSSLIAKLASLYCEVILYAVGTENSEDL
IYAERLAKDLNLKLRKKIISEEEYEEYVFKVAKAIDEVDLMKIGVGIPIYVASEMANEDG
LKVVLSGQGADELFGGYARHERIYRERGEEELKKELLKDVYNLYKVNLERDDHCTMANGV
ELRVPFLDEEVVEIALSIPIEYKMSELSNRPYAESNISLKSEPINGLKNTNLNIKCVRSV
RKKILRDVASQYLPDYIAYRPKKAAQYGSGGEKMIYKVAKKYGFSKKRINEFLDMLKRKI
VSEF
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
gtgagagacatgtgctctataagtggaataattgttaaagacaatcaaatatctgctaaa
tactccatagatatgatgaagattttaaagcacagagggagagataactctgggctgttg
ttggatgatgaagttatatattttaacgattttgaggatgttgaggatttagaggaggag
atgattggaaacttaagcttggctcataatagattggcaattgttgggaggtatggagtt
caacctattccaaatgaggatgaaactatatggttagtttgtaatggagagatttacaat
tatattgagttgagggaatatctaaaacaaaatcatgaatttaggacagacagtgataat
gaggttataattcatctatatgaagaggagaagttggaagagttggatggagactatgcc
tttgccatatatgataaatctaagaatgttgtgaggttggcaagggatatgtttggagtt
aagccattattttatgtagatagggataaatactttgcctttgcctctgaaagaaaggcg
ttgtggcatctacttataaatatcgatggctgtgagagagatttagatgagctaaatagc
aaaatcaaaacattgaagccaaattcacagttgatttattatttagatgataataggttt
gaaattattgaaggctttaaaaagttggagttaaattacatgaaagagaggagttatgag
gaggctaaggagtatttagatagagcattgaaaaactctgttttaaagagggtcaggggt
ttggacaaagttggaattatatgctctggaggagttgatagctcattgattgctaaatta
gcatctctatactgtgaagttatattgtatgccgttggaactgaaaatagtgaagattta
atctatgctgaaagattggctaaagatttaaatttaaagctaaggaagaagattatttca
gaagaggagtatgaggagtatgtgtttaaggtagctaaggcaatagatgaagttgattta
atgaagattggagttggaatccctatctatgtagcttcagagatggcaaatgaggatgga
ttaaaggttgttctatctgggcaaggagctgatgagttatttggaggctatgcaaggcat
gagagaatttatagggagagaggggaggaggagctgaaaaaagagctattgaaggatgtt
tataatttatataaggtaaatttagagagagatgaccactgtacaatggctaatggtgtt
gagttgagagttcctttcttagatgaggaggttgttgaaattgctttatcaattcctatt
gaatataagatgtctgaacttagtaacagaccttacgcagagtctaatatttcattgaaa
agtgagcccataaatgggctcaaaaataccaatttaaatataaagtgcgtaaggtctgtt
agaaagaagattttgagggatgttgcttcccagtatttgccagattatattgcctataga
ccaaagaaagccgcacagtatggaagtggtggggagaagatgatttataaggttgctaag
aaatatggattttcaaagaagagaattaatgagtttttagatatgttgaagaggaagatt
gttagtgaattttaa

DBGET integrated database retrieval system