KEGG   Methanocaldococcus jannaschii: MJ_1136Help
Entry
MJ_1136           CDS       T00003                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mja  Methanocaldococcus jannaschii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1076250..1077875
Genome map
AA seq 541 aa AA seqDB search
MVIIMDEKAKLMRCIIERILDEYNKGKTLDKKRIEQIKAECLRIHRIGIGHPSNSEILQY
ATEEEKKILIPILRKKPVRTISGVAVVAVMTSPEKCPHGKCIFCPGGVGSVFGDVPQSYT
GREPATMRGLMFNFDPYLQTKARIEQLEKVGHPTNKIELIIMGGTFPARDIEYQDWFIKR
CLDAMNGVDASSLEEAQKINETAEHRCVALCIETRPDYCGEKEINQMLKLGATRVELGVQ
TIYNEILEFCKRGHTVEDTIKATQLLKDSGLKVSYHLMPGMPGSDMEMDKKMFKEIFENP
DFKPDMVKIYPCLVIEGTELYEMWKRGEYKPYREEEAIEIISYAKSIMPKWVRTSRIQRD
IPATVIVDGVKKSNLGELVYKYMEKHGIKCKCIRCREVGHVMYKKGIMPDIEHIKLCREE
YEASGGTEIFLSYEDVKNDILIAFLRLREPYKPFRKEIDDNTMLVRQLHVCGQEKPLTKD
LKEITWQHKGYGRKLLEEAERIAKEEFGKKKILVTSGIGVREYYRKLGYERVGAYMGKYL
E
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
ttggtgattatcatggatgaaaaggcaaaattaatgagatgcatcattgaaagaatctta
gatgaatacaacaaaggaaaaaccttggataaaaagagaattgaacagattaaggcagag
tgtttaagaatacatagaattggtattgggcatccatcaaactctgagattttgcagtat
gcaactgaagaggaaaagaagatattaatcccaatattaagaaagaagcctgtcaggaca
atctctggtgttgctgttgtagcagtgatgacatctccagaaaaatgccctcatggaaaa
tgtatcttctgccccggaggagttggaagtgtatttggagatgtgccacaaagctacact
ggaagagagccagccactatgagaggtttgatgttcaacttcgacccatatttacaaaca
aaggcaaggattgagcagttggaaaaggtagggcatccaacaaataaaattgaattaatt
ataatgggaggaacatttccagcaagagatatagaatatcaagattggtttattaagaga
tgcttagatgccatgaatggcgttgatgcaagtagcttagaggaagcccaaaagataaat
gaaactgcagaacatagatgcgtagctctctgtatagaaacaaggccagattattgtgga
gaaaaggaaataaatcagatgctaaagttgggagctacaagggtagagttgggagttcaa
acaatatataatgagattttagaattctgtaagagagggcatacagttgaagacactata
aaagccacccaactattaaaggatagtggtttaaaggtttcttatcatctaatgcctgga
atgcctggctcagatatggagatggataaaaaaatgtttaaagaaatctttgaaaaccca
gatttcaagccggatatggttaaaatctatccatgtttggttattgaaggaactgaactc
tatgaaatgtggaagagaggagagtataaaccatacagagaggaagaggcaatagagata
attagctatgcaaaatcaataatgccaaaatgggttagaacttcaaggattcagagggac
attccagctactgtgatagttgatggagttaagaagagtaatttgggagagttggtttat
aaatacatggaaaagcatggaattaaatgtaagtgtataagatgcagagaagttggacat
gtcatgtataaaaaaggaataatgccggatattgagcatataaaactatgcagagaagaa
tatgaggcaagtggaggaactgagatattcctatcctatgaagatgtgaaaaacgatatc
ttgatagcatttttaagattgagagagccttataaaccatttagaaaagagattgacgat
aacacaatgttagttaggcaactccatgtctgtgggcaagaaaaaccattaactaaggat
ttgaaagaaataacttggcaacataaaggttatggaagaaaacttttagaagaggcagag
agaatagccaaagaagaatttggaaagaaaaagattttggtgacaagtggtattggagtt
agagaatattatagaaagttaggatatgaaagagttggggcctatatgggtaaatactta
gaatag

DBGET integrated database retrieval system