KEGG   Methanocaldococcus jannaschii: MJ_1165Help
Entry
MJ_1165           CDS       T00003                                 

Definition
formylmethanofuran dehydrogenase subunit FwdE
Orthology
K00204  
4Fe-4S ferredoxin
Organism
mja  Methanocaldococcus jannaschii
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mja00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MJ_1165
  Energy metabolism
   00680 Methane metabolism
    MJ_1165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1106284..1106724
Genome map
AA seq 146 aa AA seqDB search
MPEHILSGIKAIVAMKLRRKGLLQKEIAKIIKSDRSIVSHYLSGRYPKEKILNVAKIIEE
MPPQYGAKFIHSLTDNKELAKNLIKELYGIKLFWDENSCIACGSCLGCAALTLDNFTVGI
DEDTCHLCASCIFRCPTNSLKFIKEE
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgccagagcatattctctccggaataaaggcaatagtggcaatgaaattaagaagaaaa
gggcttttgcagaaggaaatagcaaaaattattaagagcgataggtcaatcgtttctcat
tatctctctgggaggtatccaaaggaaaaaatcttaaatgttgcaaaaattattgaagaa
atgccaccacaatatggagcaaagtttattcattctttaactgataataaagagcttgca
aagaacttaattaaagaattatatggtataaaacttttctgggatgaaaattcctgcata
gcttgcggttcctgtttagggtgtgcagcactcacacttgataacttcactgttggtata
gacgaagatacctgccatctatgtgcatcttgcatatttagatgtccaacaaactcatta
aaattcattaaggaggaataa

DBGET integrated database retrieval system