KEGG   Methanocaldococcus jannaschii: MJ_1185Help
Entry
MJ_1185           CDS       T00003                                 

Definition
putative aldehyde ferredoxin oxidoreductase
Orthology
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mja00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MJ_1185
   01230 Biosynthesis of amino acids
    MJ_1185
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MJ_1185
Enzymes [BR:mja01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     MJ_1185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1123161..1125029)
Genome map
AA seq 622 aa AA seqDB search
MKNALINATTKKFEIIEKTVLPITWGLYWHNKFETWKYDAYDEKNVFCFGSGVLPVIGGH
RLIFSFRSPLWDGFYFSSMGGAGYQFKSTGLNNVAIIGRCENPSILVIENDGQLRIDFIE
VKEELKTVYEVSKYILELYKDKNLRSVVVGEAAKRTNMGGLFSQTVRNGKFVEGSEDWAA
RGGGGSVLYRAHNIMGIVFFGDEKEDKEEKEKAKKIIESYYKKPMSKVVLEHTKKYRYDE
ETKTGGTFGNNWLLYKEKVPIFNWRMPYIDKEDRKKILEKILKFYLEIFNKETIEPKRWA
NCGEPCPVLCKKYRNKNKVDYEPYASNGTLLGIFDLYEADRVVKTADALGFDAIEIGNLT
AWVFELLDVGLLKEEELNIKKPIFDYKKITNDDDEEIREISKHNAEQAIKFMHNLAENSN
DLYKILSLGKRKAAKILNERFKSRVNKIGKKFNDFAVYVPFGDWGEIAPNLYWTPGFFMP
FVIQGRYLTYYKPEFNEPEKLAELVVESIKLELPIENLGICRFHRKWLKPVLKELVKELL
GIEDIVEDSINLYREICEYNKKIGYPAKIESERVKDLIIAMAKEFGNEEWTKKFENKENV
DEYVKRVLNKYSELLGIDWRIS
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgctttaataaatgcaacgacaaaaaaatttgaaatcattgagaaaactgtt
ttaccaataacttggggattgtattggcataataaatttgaaacatggaagtacgatgcc
tatgatgaaaaaaacgttttttgctttggtagtggagttttaccagttataggaggacat
aggttgatattttcttttaggtctcctctctgggatggtttttatttttcatcgatggga
ggggcaggatatcaattcaaaagcactggattaaacaatgtggcaattattggaagatgt
gaaaatccatccatattggtaattgaaaacgatggacaattgagaatagattttattgag
gttaaagaggaacttaaaaccgtttatgaagttagcaaatatattcttgaattatacaaa
gacaaaaatttgaggagtgttgttgttggtgaagcggcaaagagaacaaatatgggaggt
ttattttctcaaacagttagaaatggtaaatttgttgagggttcagaggattgggcagcg
agggggggaggaggttctgttctctatagagcccataacataatgggaatagtgtttttt
ggagatgaaaaggaagataaagaggaaaaagagaaagctaaaaagattattgaaagctat
tacaaaaaaccaatgagtaaggttgttttagagcatacaaaaaagtataggtatgatgaa
gaaacaaaaactggaggaacgtttggaaacaattggcttttgtataaagagaaagtgcca
atatttaattggagaatgccatatatagataaagaggatagaaaaaagattttagaaaaa
atacttaaattttatcttgaaatatttaataaagaaactattgagccaaaaagatgggct
aattgtggagaaccatgtcctgttttatgtaaaaagtatagaaataaaaacaaagtggat
tatgagccgtatgcatcaaatggaactttattgggaatatttgatttatatgaagcggat
agggttgttaaaacagctgatgcattggggtttgatgcaatagagattggaaatctaact
gcttgggtttttgagcttttagatgttggtttgttgaaggaggaggagctaaatataaaa
aagccaatatttgactataaaaaaataactaatgacgatgatgaagagattagagaaata
tcaaaacataatgccgaacaagctataaagtttatgcataacttagcagagaactcaaat
gatttatataaaattttatcattgggaaagagaaaggcagctaagatattaaatgagaga
tttaaaagtagagttaataagattggcaaaaaatttaatgactttgcagtttatgttcca
tttggggattggggagagatagccccaaatctctattggactcctggattttttatgcca
tttgttattcagggaagatatttaacttactacaaaccagaatttaatgagccagaaaaa
ttagctgagttggttgtagaaagtataaaattagaattaccaatagaaaaccttggtatt
tgtagattccacagaaagtggttaaaaccagtattaaaagaactggttaaagaactttta
ggtatagaagatattgtagaggattcaataaatctttatagagagatttgcgaatataac
aaaaaaattggatatcctgcaaaaattgagagtgagagggttaaagatttgattattgca
atggctaaggagtttggtaatgaggaatggactaaaaaatttgaaaataaagaaaatgta
gatgagtatgtaaaaagagttttaaataaatactctgagttattgggtattgattggaga
attagttaa

DBGET integrated database retrieval system