KEGG   Methanocaldococcus jannaschii: MJ_1334Help
Entry
MJ_1334           CDS       T00003                                 

Definition
UDP-glucose pyrophosphorylase GtaB
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mja00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MJ_1334
   00052 Galactose metabolism
    MJ_1334
   00500 Starch and sucrose metabolism
    MJ_1334
   00520 Amino sugar and nucleotide sugar metabolism
    MJ_1334
Enzymes [BR:mja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MJ_1334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1283269..1284120)
Genome map
AA seq 283 aa AA seqDB search
MIRKAVIPVAGFGTRLLPITKAQPKEMLPVVNKPIVQYVVEDLVEAGVKDILFVTGKGKQ
AIENHFDVNYELECKLEKSGKYELLKIIKEIDRLGNIFYVRQKEQKGLGDAILYGEEFVG
EEYFIAMVGDTIYSKNIVKDLIKAHEKYGCSVIALERVPKEDVYKYGVIDGEEIEKGVYK
IKNMVEKPKVEEAPSNLIITGAYLLSPKIFEKIRETPPGRGGEIQITDAMNLLLKEEDII
GVEINCKRYDIGDALGWLKANVEIGAERFPEFREFLKEFVKNL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgataagaaaggcagtaattccagtggctggttttgggactcgactattaccaataaca
aaggctcaaccgaaggagatgcttccagtagttaataagccaatagtgcaatatgttgtt
gaagatttggtagaagcaggagtaaaggatattttatttgtaactgggaagggaaaacag
gcaatagaaaaccactttgacgtaaattatgagttggagtgtaaattagagaaatctgga
aaatatgaacttctaaaaattattaaagaaattgataggttagggaatatattttatgta
agacagaaagagcagaaaggtttaggagatgctattttgtatggggaggaatttgttggg
gaggaatactttatagcaatggttggagatacaatttactctaaaaatattgtaaaagat
ttaataaaagctcatgaaaaatacggctgttcagttattgcattagagagagttccaaaa
gaagatgtttataaatatggagtaattgatggggaagagatagaaaagggcgtttataaa
ataaaaaatatggtagaaaaaccaaaagttgaagaggcaccttcaaatttgattataacc
ggggcttatttattatctccaaagatatttgaaaaaattagagaaactcctcctggaaga
ggaggagagattcagattacagatgctatgaatctacttttaaaagaggaagatattata
ggggttgaaattaactgtaaaagatatgatattggggacgctcttggatggttaaaagca
aatgtagaaattggagctgaaagattccctgaatttagagaattcttaaaagaattcgtt
aaaaatttataa

DBGET integrated database retrieval system