KEGG   Methanocaldococcus jannaschii: MJ_1418Help
Entry
MJ_1418           CDS       T00003                                 

Definition
fuculose-1-phosphate aldolase FucA
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mja00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MJ_1418
Enzymes [BR:mja01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MJ_1418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1381145..1381690
Genome map
AA seq 181 aa AA seqDB search
MDKKQFIKICRKLYDRKYVVGSGGNVSVKEGDKIYLTPTGSILGFLKEDDIAEMDLDGNV
IKGKPTSEKNLHLMIYRKRNDINAIIHTHSLISTFLSTINKEIELLTPEGKIFLKKIGYV
DYYEAGSLKLAEETAKRDEDVIILKNHGVVCLGKDLIDAYIKVEVLEEQAKLTLLNLLVK
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaaagcaatttattaaaatatgtagaaaattgtatgataggaaatatgttgta
ggtagtggaggcaatgtatcagttaaagagggggataaaatatatctgactccaactggc
tctattttagggtttttaaaggaagatgatatagctgaaatggatttggatggtaatgtt
ataaaaggaaaacctacatcagaaaaaaatctccacttaatgatttatagaaaaagaaat
gacataaacgcaataatccacactcattcacttatatcaacttttttatcgacaataaac
aaagaaatagaacttttaacaccagaaggaaaaatatttttgaagaaaattggttatgtt
gattactatgaggcaggtagtttaaaattagctgaagaaacagcaaaaagagatgaggac
gttattatattaaaaaatcatggagtagtttgtttaggtaaagatttgatagatgcatat
ataaaagtggaggttttagaagaacaagctaaacttacacttttaaaccttcttgtaaag
aaatag

DBGET integrated database retrieval system