KEGG   Methanocaldococcus jannaschii: MJ_1456Help
Entry
MJ_1456           CDS       T00003                                 

Definition
(GenBank) histidinol dehydrogenase (hisD)
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mja  Methanocaldococcus jannaschii
Pathway
mja00340  Histidine metabolism
mja01100  Metabolic pathways
mja01110  Biosynthesis of secondary metabolites
mja01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mja00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    MJ_1456
Enzymes [BR:mja01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     MJ_1456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AAB99465
UniProt: Q58851
Position
1425716..1427005
Genome map
AA seq 429 aa AA seqDB search
MVTGMIIKKIKELTKEEEEKIINRNKANFEEILPTVMEILKDVKEKGDEALKYYTKKFDG
VEIEDFKVTDEEIEEAYNSVDYKVVEAIERAKENIYFFHKKQMEQIKDLNVENNGIILGQ
VVRAIEKVGCYVPGGRAFYPSTVLMTTIPAKVAGCEEIYITSPPTKDGKGNPATLIAGDI
VGVSAIYKVGGVQAIGALAYGTETIPKVDIIVGPGNIYVTTAKKMVYGEVAIDFLAGPSE
VLIIADETANAEFVALDFIAQAEHDPNASCVITTTSEKKAEEIKNKIFEEIEKAERKEII
LKALENSAILIGDLEECIEFSNKYAPEHLEILTKNPEEVLNKIKHAGSVFLGEYSPVPVG
DYASGTNHVLPTSQFARMSSGLNVETFLKKITYQKLDKESLKNIADIVITLAEAEGLFGH
AEAVRRRLK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggtgactggaatgataattaaaaaaattaaagaattaacaaaggaagaagaggagaaa
ataattaataggaataaagcaaactttgaggaaatattgccaacagtaatggagattttg
aaggatgttaaagaaaaaggggatgaagcattaaaatattatacaaaaaagttcgatggt
gtagaaatagaagattttaaagttacagatgaggagatagaagaagcttataactcagtt
gattataaagttgttgaagctattgagagagctaaggaaaacatttatttcttccataaa
aagcagatggagcaaataaaagatttaaatgttgaaaataatggaataattttaggacag
gttgttagagcaatagaaaaagttggatgctatgttcctggaggaagggcattttatcct
tcaactgttttaatgacaacaattcctgcaaaggttgctggatgtgaagagatatatata
acctccccacctacaaaagatgggaaaggaaatccagctaccttaatagcaggagatatt
gttggagtttcagctatttataaggttggaggagttcaagctataggggcattagcctat
ggaacagagactatcccaaaggttgatattattgtagggcctgggaatatatatgtaaca
acagctaaaaagatggtttatggagaagttgccatagatttcttagcaggtccttcagag
gttttaattattgctgatgaaacagctaatgcagagtttgttgccttagattttattgcc
caagctgaacacgaccctaacgcctcttgtgtaataacaacaacatctgaaaagaaggca
gaggagattaaaaacaagatatttgaagagatagaaaaagctgaaagaaaggagattatt
ttaaaagccttagaaaactctgccatattaattggtgatttagaagagtgtattgaattc
tcaaataaatatgccccagaacatcttgaaatattaactaaaaatccagaggaagtttta
aataaaattaaacatgctggaagtgtatttttaggagagtatagcccagttcctgttgga
gattatgcttctggaactaatcatgttctgccaacttcacagtttgcgagaatgagttct
ggtttgaatgtagagacatttttaaagaaaataacatatcaaaaattggataaggaaagc
ttaaaaaatattgctgatattgttatcacattagctgaagctgaaggtttgtttgggcat
gctgaagctgttagaagaagattaaaataa

DBGET integrated database retrieval system