KEGG   Methanocaldococcus jannaschii: MJ_1465Help
Entry
MJ_1465           CDS       T00003                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mja00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MJ_1465
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MJ_1465
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MJ_1465
Enzymes [BR:mja01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MJ_1465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1434196..1435413)
Genome map
AA seq 405 aa AA seqDB search
MLQRCIKCGKTYDVDEIIYTCECGGLLEIIYDYEEIKDKVSEEKLRKREIGVWRYLEYLP
VKDESKIVSLCEGGTPLYRCNNLEKELGIKELYVKNEGANPTGSFKDRGMTVGVTRANEL
GVEVVGCASTGNTSASLAAYSARSGKKCIVLLPEGKVALGKLAQAMFYGAKVIQVKGNFD
DALDMVKQLAKEKLIYLLNSINPFRLEGQKTIAFEICDQLNWQVPDRVIVPVGNAGNISA
IWKGFKEFEITGIIDELPKMTGIQADGAKPIVEAFRKRAKDIIPYKNPETIATAIRIGNP
VNAPKALDAIYSSGGYAEAVTDEEIVEAQKLLARKEGIFVEPASASSIAGLKKLLEEGII
DRDERIVCITTGHGLKDPDAAIRASEEPIKIECDMNVLKRILKEL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgttacaaagatgtattaaatgtggaaaaacttacgatgtggatgagataatctacacc
tgcgaatgtggtggcttattggagattatttatgattatgaagagattaaagataaagtt
tcagaagaaaaactaagaaagagagaaattggagtctggagatatttggaatacttacca
gtaaaagacgaaagtaaaattgtaagtctatgtgaaggaggaactccattatatagatgt
aacaacttggaaaaagagcttggaattaaagaactctatgtaaaaaatgaaggggctaat
ccaactggaagctttaaagatagggggatgactgttggagtaacaagggcaaatgagttg
ggtgttgaggttgttggctgtgcttcaacaggaaatacatccgcttctttagccgcttac
tcagcaagaagtggaaagaaatgtattgttctattaccagaaggaaaagttgccttagga
aagttagctcaagcaatgttctatggagctaaggttattcaagtcaaagggaactttgat
gatgcattagatatggttaaacaattagcaaaagagaagttgatttatttattaaattca
ataaatccatttagattagagggacagaaaaccatagcatttgaaatatgtgaccaatta
aactggcaagtcccagatagagttattgttccagttggaaatgctggaaacatctcagct
atatggaaaggatttaaagaatttgaaattactggcattatagatgaactcccaaaaatg
accggaattcaggcagatggagctaagccaattgttgaagcatttagaaagagagctaaa
gacatcatcccatataaaaatccagagacaattgcaacagctataaggattggaaatcca
gtaaatgccccaaaggctttagatgccatatactcctctggaggttatgctgaagcagtt
actgatgaagagattgttgaagctcaaaagctattggcaagaaaagagggaatttttgtt
gaaccagcttcagcttcatcaatagctgggcttaaaaagttattagaagaaggaattatt
gatagagatgaaagaattgtttgtataacaacagggcatgggttgaaagacccagatgca
gctataagggcaagtgaagagccgataaagattgaatgtgatatgaatgttttaaaaaga
attttgaaagagttataa

DBGET integrated database retrieval system