KEGG   Methanocaldococcus jannaschii: MJ_1519Help
Entry
MJ_1519           CDS       T00003                                 

Definition
exodeoxyribonuclease V RecD
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mja00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MJ_1519
Enzymes [BR:mja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MJ_1519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1494089..1497616
Genome map
AA seq 1175 aa AA seqDB search
MRNLISLIAWHDSGWNGRVCRNPKENKYCESFGYVIRKRKYEFCVNNPDANLGNSRERAC
SEAIVFCKGKVQEHNIRFPAIFYVDRKNRNEHEIKMIKKEIEEQLRMINGKYAILYVREN
PLSENRVIVGCVKIKEIIDGSKDYIRKKQSPNRVGRGIVFDVENDVIFALPYQELLEYCK
NKNKEIEEILKEFNLIFEVGDFERYFKGMSNFISDEVAVQILKKGLEIVEEFNKFREENQ
DFDKYLTDENIAFRPHVMKKFDEFAENIKKVIAELEGSKYKYPGLPGVLYFLGMEDAYSR
YIELWKNEGEKGEEKLYNALIESLENRKENLEFGITKKVIDKFIAQKEEFREFLKNYAVY
YELSAFKLEKIKEQYEKEFINLDNIIKNPYILVEDLKENDSFERIIFEELDSWERRRLGD
KFNPYSPYRVRALLVEILKRHLSSGNTTISTKDLKDFFEKMDKDIVKITFDEFLRIIEEY
KDIISEKVEIVKKEVKNNENKEIIELFTLKEIREYEEIIENTINYLLKSKAPNIDLNPLE
IREKLRIKNENKKPAGVDNEEYEKALDMQTEAVVNLLKNRVGILTGPAGTGKTTVIKTIM
ELMKEVLGLNKIYILTPTGKSAMVVNEKLNNLATAKTIHRYIAEEFKDYFEGDNYFILRL
DKITGNDKKEIDALIIDESSMVDIETMGRLLGTIKLDNLKYLIFVGDINQLPPVGAGKPF
YDIYNYLEKVNPQSICKLEIVLRADSKKIVELSKLFLDIDKEERIKILNEMFKNKETLGD
NEIYRIKENIGGIEKEIITIEVVKDGNIKKSLENAIETILKENNTEDFFDFAVFNDKLQI
LVPTKTKGEFGSYMINLFIKQESKFIPDKYKNKMLENWFFGDGKVADKVIQIRNNYKKWV
YDTERRKWVKEHGVFNGMMGFAYTFKKWNKYQKKYENKTIIRFYYPKIEAYTDEKEMEHA
YAITIHKSQGSGFENVILIIPKGLNKFVSKEMLYTAITRAKKRLYVIVEEELKNFLETNI
SDLARRKTNLLENFNISYLVPYIENRQIITINGEKVRSWQECVLANLFHEVGIEYIYELL
SEYLKIGVLPDFKLNIKNRTILWEHYGMLENEKYRKRQKEEKEPIYKQNGFEIIKLSEIN
ENTKLGDKVLIISTSEDLKNNSQVLEKLKTLQQIS
NT seq 3528 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatttaatatctttgatagcgtggcatgattctggatggaatggtagagtttgt
agaaatccaaaagaaaataaatattgtgagagctttggatatgtgataagaaagagaaag
tatgaattttgtgtaaataatccagatgctaatttaggaaattcaagagaaagagcatgt
agtgaagcaatagtattttgtaaagggaaagtacaggagcataacataagatttccagca
atattttatgttgatagaaaaaacagaaatgaacatgaaataaaaatgataaaaaaagaa
attgaagaacaattaagaatgattaacggaaaatacgcaatactttatgttagagaaaat
cctttatctgaaaatagagtaatagtcggatgtgttaaaataaaggaaataatagatggt
agcaaggattacattagaaaaaaacagagtcctaatagagtaggaagaggcattgttttt
gatgtagagaatgatgtaatatttgctttaccttatcaagaactcttagaatactgcaaa
aataaaaataaagaaattgaagaaattctaaaagaatttaatttaatttttgaagttggg
gactttgaaagatactttaaaggcatgtctaactttatatccgatgaggtggcagtccaa
attcttaaaaaagggcttgaaattgttgaggaattcaataaatttagagaagaaaatcag
gactttgataaatacttaactgatgagaatatagcatttagacctcatgttatgaaaaag
tttgatgaattcgctgaaaatataaaaaaggttattgcagaacttgaaggtagtaaatat
aaatatcctggacttcctggagttctttatttcttaggaatggaagatgcttactcaaga
tatattgaactttggaaaaatgaaggagaaaaaggagaagagaaactttataatgcatta
attgaaagtttagaaaatagaaaagaaaatttagagtttggaattacaaaaaaggttata
gacaaatttatagcacagaaggaagagtttagagagtttttaaaaaattatgctgtttat
tatgagttatctgcatttaaacttgaaaaaattaaggaacaatatgaaaaagaatttatt
aatttagataacataataaaaaatccatacattttggttgaggatttaaaagaaaatgat
agttttgaaaggataatatttgaagagcttgactcatgggaaagaagaagattgggggat
aaatttaatccttacagtccatatagagttagagctttattggttgaaattctaaaaagg
catttaagttcaggaaacactacaatttcaacaaaagaccttaaagatttctttgaaaaa
atggataaagacattgtaaagataacttttgatgaatttttaaggataattgaggaatat
aaagacataatatctgaaaaagttgaaatagtcaaaaaagaagttaaaaataatgaaaat
aaagaaattattgaattatttaccctaaaagaaattagagaatatgaggagataattgaa
aataccataaattatctcttaaagtcgaaagctccaaatattgatttgaatccattagaa
attagagaaaaattaagaataaaaaacgaaaataaaaaaccagcgggagttgataatgaa
gaatatgaaaaagctttagatatgcaaactgaggcagttgtaaatctacttaaaaataga
gttggaatattaacaggaccagcaggcactggaaaaacaacggtcataaaaacaattatg
gaattaatgaaggaagtgcttggattaaataaaatctacatattaacaccaactggaaag
tcagcaatggtcgttaatgaaaaattaaataatttagcaactgcaaaaacaatacataga
tatattgcagaggaatttaaagattattttgagggagataattatttcatccttagattg
gataaaataactggtaatgacaagaaagaaattgatgctttaattatagatgaatcatca
atggtagatattgaaacaatgggaagattattgggaacaataaaattggataatttgaag
tatttaatatttgttggagacattaaccaattgccaccagttggtgctggaaaacctttc
tatgacatttataactatttagaaaaagttaatccacaatcaatatgtaaattggaaatt
gtcttaagggctgactctaagaagattgttgaactttcaaaattgtttttagatattgat
aaagaagaaagaataaaaattttgaatgaaatgtttaaaaataaagaaactttaggagat
aatgaaatctataggattaaagagaatattggtggcatagaaaaggaaataataacaata
gaagttgttaaagatggaaacattaaaaaatcgttagagaatgctatagaaaccatacta
aaagaaaataatacagaagatttctttgactttgcagtttttaatgataaattacaaatt
ttagttccaacaaaaactaagggagaatttggttcatatatgattaatttattcataaaa
caggaatcaaagtttattccagacaaatataaaaataaaatgttggagaattggtttttt
ggagatggtaaagttgcagataaagttatacaaattagaaacaattacaaaaaatgggtt
tatgatactgaaagaaggaaatgggtaaaagaacatggcgtatttaatggaatgatgggt
ttcgcctacactttcaaaaaatggaacaaataccagaaaaaatatgaaaataaaaccatt
ataaggttctactatccaaaaatagaagcatatacagatgaaaaagaaatggaacatgcc
tatgcaataacaattcataaaagtcaaggtagtggatttgaaaatgtcatcttaataatt
ccaaaaggattgaacaaatttgtctcaaaagaaatgctatatactgcaataacaagagct
aaaaaaagattgtatgttattgttgaagaagagcttaaaaacttcttagaaacaaatatt
tctgacttagcaaggagaaaaactaatctccttgaaaattttaacatttcatatttagtt
ccttatattgaaaatagacaaattataacaataaatggggaaaaagttagaagttggcaa
gaatgtgtattggcaaatctcttccatgaggtaggaatagaatatatttatgaactacta
tcagaatatttaaaaattggagttcttcctgacttcaaattaaatataaaaaatagaaca
attctttgggaacattatggtatgttagaaaatgaaaagtatagaaaaagacagaaagaa
gaaaaagaacccatatataaacaaaatggatttgagataattaaactctcagaaattaat
gaaaatactaagttgggggacaaggttttaattatttcaacatctgaggatttaaaaaat
aatagtcaagtattggaaaaactaaaaactctgcaacaaatttcttaa

DBGET integrated database retrieval system