KEGG   Methanocaldococcus jannaschii: MJ_1528Help
Entry
MJ_1528           CDS       T00003                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mja00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MJ_1528
   01230 Biosynthesis of amino acids
    MJ_1528
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MJ_1528
   00051 Fructose and mannose metabolism
    MJ_1528
   00562 Inositol phosphate metabolism
    MJ_1528
Enzymes [BR:mja01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MJ_1528
Exosome [BR:mja04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MJ_1528
  Exosomal proteins of bladder cancer cells
   MJ_1528
  Exosomal proteins of melanoma cells
   MJ_1528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1505740..1506399)
Genome map
AA seq 219 aa AA seqDB search
MLIVINYKTYNESIGNRGLEIAKIAEKVSEESGITIGVAPQFVDLRMIVENVNIPVYAQH
IDNINPGSHTGHILAEAIKDCGCKGTLINHSEKRMLLADIEAVINKCKNLGLETIVCTNN
INTSKAVAALSPDYIAVEPPELIGTGIPVSKANPEVVEGTVRAVKEINKDVKVLCGAGIS
KGEDVKAALDLGAEGVLLASGVVKAKNVEEAIRELIKFI
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgttgatagtaattaactataaaacatacaatgaaagtataggaaatagaggtttagag
atagctaaaattgctgagaaagttagtgaagaaagtggaattacaataggagtagctcct
caatttgtagatttaaggatgattgttgaaaatgtcaatattccagtttatgctcaacat
atagataatataaaccctggaagtcatactggacatatattggctgaagctattaaagat
tgtggttgtaaaggaactctaataaaccattcggagaagagaatgctgttggctgatatt
gaagcagttataaataaatgcaaaaatttaggattagaaacaattgtctgcacaaataat
ataaacacttctaaggcagttgcagccctaagccctgattatattgctgttgaaccacca
gagcttataggaactggaattccagtatcaaaggcaaatccagaggttgttgagggaact
gttagggcagttaaagagataaacaaggatgtcaaagttttatgtggagctggaatttct
aaaggagaagatgttaaagcagcccttgatttgggagctgagggtgttttattagcttct
ggagtagttaaagcaaagaatgtagaagaggctataagagaattaataaagttcatctaa

DBGET integrated database retrieval system