KEGG   Methanocaldococcus jannaschii: MJ_1528Help
Entry
MJ_1528           CDS       T00003                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mja  Methanocaldococcus jannaschii
Pathway
mja00010  Glycolysis / Gluconeogenesis
mja00051  Fructose and mannose metabolism
mja00562  Inositol phosphate metabolism
mja01100  Metabolic pathways
mja01110  Biosynthesis of secondary metabolites
mja01120  Microbial metabolism in diverse environments
mja01130  Biosynthesis of antibiotics
mja01200  Carbon metabolism
mja01230  Biosynthesis of amino acids
Module
mja_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mja_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mja00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MJ_1528
   00051 Fructose and mannose metabolism
    MJ_1528
   00562 Inositol phosphate metabolism
    MJ_1528
Enzymes [BR:mja01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MJ_1528
Exosome [BR:mja04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MJ_1528
  Exosomal proteins of bladder cancer cells
   MJ_1528
  Exosomal proteins of melanoma cells
   MJ_1528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM NMO FMN_dh His_biosynth ThiG IGPS Hydrolase_like Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AAB99546
UniProt: Q58923
Structure
PDB: 

Jmol
Position
complement(1505740..1506399)
Genome map
AA seq 219 aa AA seqDB search
MLIVINYKTYNESIGNRGLEIAKIAEKVSEESGITIGVAPQFVDLRMIVENVNIPVYAQH
IDNINPGSHTGHILAEAIKDCGCKGTLINHSEKRMLLADIEAVINKCKNLGLETIVCTNN
INTSKAVAALSPDYIAVEPPELIGTGIPVSKANPEVVEGTVRAVKEINKDVKVLCGAGIS
KGEDVKAALDLGAEGVLLASGVVKAKNVEEAIRELIKFI
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgttgatagtaattaactataaaacatacaatgaaagtataggaaatagaggtttagag
atagctaaaattgctgagaaagttagtgaagaaagtggaattacaataggagtagctcct
caatttgtagatttaaggatgattgttgaaaatgtcaatattccagtttatgctcaacat
atagataatataaaccctggaagtcatactggacatatattggctgaagctattaaagat
tgtggttgtaaaggaactctaataaaccattcggagaagagaatgctgttggctgatatt
gaagcagttataaataaatgcaaaaatttaggattagaaacaattgtctgcacaaataat
ataaacacttctaaggcagttgcagccctaagccctgattatattgctgttgaaccacca
gagcttataggaactggaattccagtatcaaaggcaaatccagaggttgttgagggaact
gttagggcagttaaagagataaacaaggatgtcaaagttttatgtggagctggaatttct
aaaggagaagatgttaaagcagcccttgatttgggagctgagggtgttttattagcttct
ggagtagttaaagcaaagaatgtagaagaggctataagagaattaataaagttcatctaa

DBGET integrated database retrieval system