KEGG   Methanocaldococcus jannaschii: MJ_1585Help
Entry
MJ_1585           CDS       T00003                                 

Definition
aldolase
Orthology
K16305  
fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mja  Methanocaldococcus jannaschii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mja00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MJ_1585
   01230 Biosynthesis of amino acids
    MJ_1585
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MJ_1585
   00030 Pentose phosphate pathway
    MJ_1585
   00051 Fructose and mannose metabolism
    MJ_1585
  Energy metabolism
   00680 Methane metabolism
    MJ_1585
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MJ_1585
Enzymes [BR:mja01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     MJ_1585
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     MJ_1585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1558246..1559178)
Genome map
AA seq 310 aa AA seqDB search
MGIFMIKRLKKRDVKVPLTVPEDRKEEYIKNYLELTKRTGNVMLFAGDQKIEHLNDDFFG
EGIAKDDASPEHLFNIASKGKICGFATQLGLIARYGMDYKKIPYIVKINSKTHLVKTRDP
ISRALVHVKDVVDLKENSGLKILGVGYTIYPGSEYEHIMFEEASRVILEAHKHGLIAIIW
SYPRGKNVKDEKDPHLIAGAAGVAACLGADFVKVNYPKCDNPAERFKEAVLAAGRTGVLC
AGGKSIEPEKFLKQIWEQINISGARGNATGRNIHQKPLDAAIRMCNAIYAITIEGKSLEE
ALKIYYGDRK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtggggatttttatgataaagaggttaaaaaagagagatgtaaaagtgccactaacagtt
ccagaagacagaaaagaagaatacataaaaaactacttagaattaacaaaaagaactgga
aatgtaatgctattcgctggagaccagaagattgaacatttaaatgacgacttctttggg
gaggggatagctaaggatgacgcatctccagaacatctgtttaatatagcaagtaaaggg
aaaatctgcggatttgcaacacaactcggattaatagcaagatatggaatggattataaa
aaaattccctatattgtgaagattaactcaaaaactcatcttgttaaaacaagagaccca
ataagtagggctttagtgcatgttaaagatgttgttgatttaaaagaaaactctggatta
aaaatattgggggttggttatacaatctatcctggaagtgagtatgaacatataatgttt
gaagaggcatcaagggttatattagaagctcacaagcatggcttaatagcaataatctgg
agctatccaagagggaagaatgttaaagatgagaaagaccctcacttaattgctggagct
gctggagttgccgcatgcttaggggctgattttgttaaagttaattatccaaagtgtgat
aatccagcagagaggtttaaagaggctgtcttagccgctggaagaactggagttctatgt
gctggaggtaaaagtatagagccagaaaaatttttaaaacagatttgggagcaaattaat
attagtggggcaagaggaaatgcaactggaagaaatatccaccaaaagcctttagatgcc
gctataaggatgtgtaatgcaatatatgcgataaccattgaagggaagagtttggaggag
gctttaaagatatactatggagataggaaataa

DBGET integrated database retrieval system