KEGG   Mycobacterium sp. JDM601: JDM601_0088Help
Entry
JDM601_0088       CDS       T01512                                 

Definition
oxidoreductase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
mjd  Mycobacterium sp. JDM601
Brite
Enzymes [BR:mjd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     JDM601_0088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
91484..92509
Genome map
AA seq 341 aa AA seqDB search
MKAHPKLVIGANGFLGSHVTRQLVDAGEDVRVMVRPSANTIGIDDLDVTRYHGDVFDTAT
LREAMTGCDDIYYCVVDTRAWLRDPAPLFRTNVEGLRNVLDVAIEEPVAAGLRRFVFTSS
YVTVGRRRGHVATETDQIDRRRLTPYVRSRVQAEDLVLRYAADAGLPAVAMCVSSTYGDG
DWGRTPHGAFIAGAVYGKLPFVMDGIRLEAVGVDDAARALILAAEHGRNGERYLISERMI
TNGEIIAIAADEAGVPPPARSISVPMLYALGALGALKARLGRKDAELSWKSVRMMRAESE
VDHSKAVRELGWQPRPVEESIREAARFWMKLRDARKRGTAA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggctcaccccaagcttgtcatcggtgccaacggattcctcggctcacacgtcacc
cgccagctcgtcgacgccggtgaagacgtccgggtcatggtgcgcccgagcgccaacacc
atcggaatcgacgacctcgacgtcacccggtaccacggcgatgtgttcgacaccgccacg
ctgcgcgaggcgatgaccggctgcgacgacatctactactgcgtcgtcgacacccgcgcc
tggctgcgcgatccggccccgctgttccgcaccaacgtcgaagggctgcgcaacgtgctc
gatgtggcgatcgaggagccggtcgccgccggcctgcgccggttcgtgttcaccagcagc
tacgtcaccgtcggccgtcgccgcggccatgtcgccaccgagaccgaccagatcgaccgc
cgccgactgaccccctacgtgcggtcccgggtgcaggccgaagacctggtgctgcgctat
gcggccgacgccggactgccggcggtggcgatgtgcgtatcgagcacctacggcgacggc
gactggggccgcaccccgcacggcgcgttcatcgccggcgccgtctacggcaagctgccg
ttcgtgatggacggtatccggctggaggccgtcggggtcgacgacgccgcgcgggcgctg
atcctggccgccgagcacggccgcaacggtgagcggtacctgatctccgagcggatgatc
accaacggcgagatcattgcgatcgcggccgacgaggccggggtgccgccgccggcgcgg
tcgatctcggtgccgatgctgtatgccctgggggcgctgggcgcgctgaaggcccggctg
ggccgcaaggacgccgagttgtcgtggaagtcggtccggatgatgcgcgcggagtccgaa
gtcgaccactccaaggcggtgcgcgagctgggctggcagccccggccggtggaggaatcg
atccgggaggcggcgcgtttctggatgaaactgcgcgatgccaggaagcgagggaccgcc
gcatga

DBGET integrated database retrieval system