KEGG   Mycobacterium sp. JDM601: JDM601_0220Help
Entry
JDM601_0220       CDS       T01512                                 

Gene name
lpqI
Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    JDM601_0220 (lpqI)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    JDM601_0220 (lpqI)
Enzymes [BR:mjd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     JDM601_0220 (lpqI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
230700..231887
Genome map
AA seq 395 aa AA seqDB search
MPASLTRHLPGLLLAAALLPALTTACSHRTETPAPSTPAESTDTSTAAAPVDPACKQLAA
LPVRDKLAQLVMVGVRDAADARAVVTDHHVGGIFIGSWTELSMLTDGSLTEIKEDQAAAG
PLPLAVSVDEEGGRVARLSSLIGSSPSAKELAATHSAAQVRELAAERGRKMADLGITIDF
APVVDVVAAGTDDDTVIGDRSFGSDPAKVTEYAGAYAQGLRDAGLLPVLKHFPGHGHGSG
DSHTAGAVATPPLAQLQDNDLVPYRTLVTQAPVAVMMGHLEVPGLTEDPASLSPAAVSLL
RAGTDYHGPAFSGLVFTDDLSSMAAITEHYGVADAVLRSLQAGVDIALWVTTDEVPAVLD
RLEQAVAAGELKREAIDASLARLAAVKKPGTHCHG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcatcgctgactcgacacctgcccggtctgctgttggcggccgcgttgctgccg
gcgctgacgaccgcctgctcccaccgcaccgagacacccgcgccgtcgacaccggcggag
tcgacggacacctcgacggccgccgcgccggttgacccggcctgcaagcagttggcggct
ctgccggtccgcgacaagctcgcgcagctggtgatggtcggcgtccgtgacgcggccgac
gcgcgcgcggtggtcaccgaccatcatgtcggcggcatcttcatcggcagctggaccgag
ctgtcgatgctgaccgacggttcgctgaccgagatcaaggaagaccaggccgccgccggt
ccgctgccgctggcggtcagtgtcgacgaagagggcggccgggtggcgcggctgtcctcg
ctgatcgggtcctcgccgtcggccaaggagctggcggctacccacagcgccgcgcaggtg
cgcgagctggcggccgagcgcggccgcaagatggccgacctgggcatcaccatcgacttc
gcgcccgtggtcgacgtggtcgccgccggcaccgacgacgacaccgtgatcggcgaccgc
tcgttcggctcggacccggccaaggtgaccgagtacgccggggcgtacgcgcagggactg
cgtgacgccgggctgctgccggtgctcaaacacttccccggccacggccacggctccggt
gactcgcacaccgccggggcggtggccacgccaccgctggcgcagctacaggacaacgac
ctggtgccctatcgcacgctggtcacccaggcgccggtggcggtgatgatgggacacctg
gaggtgcccggcctgaccgaggacccggccagcctgagtcccgccgcggtcagcctgttg
cgcgccggcaccgactatcacggcccggcgttctccgggctggtattcaccgacgatctg
tcgtcgatggccgccatcaccgaacactacggcgtcgccgatgcggtgttgcgaagcctg
caggccggcgtggacatcgcgctgtgggtcaccaccgacgaggtgccggcggtgttggac
cggctggagcaggcggtggcggcgggcgagttgaagcgtgaggcgatcgatgcctcgttg
gcgcggttggcggcggtcaagaaaccgggaacgcactgccacggctga

DBGET integrated database retrieval system