KEGG   Mycobacterium sp. JDM601: JDM601_0240Help
Entry
JDM601_0240       CDS       T01512                                 

Definition
bifunctional uroporphyrinogen-III synthetase/response regulator domain-containing protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    JDM601_0240
Enzymes [BR:mjd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     JDM601_0240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(252308..253447)
Genome map
AA seq 379 aa AA seqDB search
MTRPDRAALSGYRVAVTSSRRADELCTLLRRHGATVCAAPAIDMVDLTDDDELHCCTEEL
IARPPDILVVTTAIGFRGWIAAAEGWGLADELIEALHTARIVARGPKAVGALRAADLPEE
WSPESESSAAMLGYLRAAGVCGHHIAVQLHGTSGGWDPAPELLDRLRCAGAEVTPIQVYR
WRAARPGGEFDQLTTEIAQRQFDAVSFTSAAAVMATLTRAVELGISDELLGALRSEVHAM
CVGPLTARPLTQLGVPTSSPRRMRLGALARHIVDQLPRLRSRAVYAAGHRIEVRSSCVMV
DGVAKAVSPAGMATLRALARHPGKVVSRDDLLDALPGNGRSTHAVETAVLRLRNTLGDKN
IIATVVKRGYRLAVDQPNG
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgacccggccggaccgggcggcgctgagcggctaccgggtcgcggtgacctcgtcgcgt
cgcgccgacgagctctgcaccctgcttcggcgccacggtgccaccgtctgtgccgctccg
gcgatcgacatggtcgacctcaccgatgacgacgaattgcactgctgtacggaggaattg
atcgcgagaccacccgacattctggtggtgacgaccgcgatcggtttccgcggctggatc
gccgccgccgaggggtggggactggccgatgaactcatcgaggcgttgcacaccgcccgg
attgtcgctcgtgggccgaaggcggtgggcgcactgcgcgcggcggacctgcccgaggag
tggtcgccagaatccgaatcttcggccgcgatgctcggctacctgcgggccgcgggtgtc
tgcggccaccacatcgcggtccagctgcacggcaccagcggcggctgggatccggctccc
gagctactcgaccgactccgttgtgcgggcgccgaagtgacgcccattcaggtctaccgg
tggcgggcggcccggcccggtggagagttcgaccagttgaccaccgagatcgcccagcgg
cagttcgacgccgtcagcttcacctcggccgcggcggtgatggccacgctcacccgcgcc
gtcgagctcggcatctccgatgagctgctcggcgcgctgcggtcggaggtacacgcgatg
tgtgtgggtccgctgacagcccggccgctgacgcagctcggtgtccccacgtcgtcaccg
cggcggatgcggctgggggcgttggctcgccacatcgtggaccagcttccccggttgcgc
tcccgcgccgtgtacgccgccggccaccggatcgaggttcgcagcagttgcgtgatggtc
gacggggtggccaaggcggtgtcacccgccgggatggcgacgctgcgcgcgttggctcgt
catcccggaaaggtggtgtcccgtgacgacctgctcgacgccctgccgggcaacggccgt
agcacgcacgcggtggaaacggcggtgctgcggctacgaaatacgctgggcgacaaaaac
atcatcgctaccgtcgtgaaacgcggttatcggcttgcggtcgaccagccgaacggttaa

DBGET integrated database retrieval system