KEGG   Mycobacterium sp. JDM601: JDM601_0458Help
Entry
JDM601_0458       CDS       T01512                                 

Gene name
icl
Definition
isocitrate lyase Icl
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    JDM601_0458 (icl)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    JDM601_0458 (icl)
Enzymes [BR:mjd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     JDM601_0458 (icl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
476709..477995
Genome map
AA seq 428 aa AA seqDB search
MSTVGTPKSPEQIQHDWDNNPRWKGVTRTYTAADVVALQGHVVEEHTLARRGAEVLWEQL
HDLDYINALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVPQV
VRRINNALLRADEIAKVEGDTSVENWLAPIVADGEAGFGGALNVYELQKAMIAAGVAGSH
WEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVAGVPTVVIARTDAEAATLITSD
VDERDQPFITGDRTAEGFYRVRNGLEPCIARAKAYAPYADLIWMETGTPDLELARKFAEG
VKAEFPDQMLAYNCSPSFNWKQHLDDATIAKFQNELGAMGFKFQFITLAGFHALNYSMFD
LAHGYARNQMSAYVELQEREFAAEERGYTATKHQREVGAGYFDRIATTVDPTSSTTALAG
STEEGQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgttggcacgccgaagagccccgagcagatccagcacgactgggacaacaat
ccgcgctggaagggtgtcacccgcacctacaccgcggcggacgtcgtcgcgctgcaaggc
cacgtcgtcgaggagcacaccctggcccgccgcggcgccgaggtgctctgggagcagctg
cacgacctggactacatcaacgccctcggtgcgctgaccggcaacatggccgtccagcag
gtccgggccggcctgaaggccatctacctgtccggctggcaggtcgccggtgacgccaac
ctgagcggccacacctaccccgaccagagcctctacccggccaactcggtgccgcaggtg
gtccgccggatcaacaacgcgctgctgcgcgccgacgagatcgccaaggtcgagggcgac
acctcggtcgagaactggctggccccgatcgtggccgacggtgaggccggcttcggtggc
gcgctcaacgtctacgagctgcagaaggcgatgatcgccgcgggcgtcgcgggctcgcac
tgggaggaccagctggcctcggagaagaagtgcggccatttgggcggcaaggtgctgatc
cccacccagcagcacatccgtaccctgacctcggcccggctggccgccgacgtggccggt
gtgccgaccgtggtgatcgcccgcaccgacgccgaggccgccaccctgatcacctccgac
gtcgatgagcgcgatcagccgttcatcaccggtgaccggaccgccgagggcttctaccgg
gtgcgcaacggcctggagccgtgcatcgcccgggccaaggcctacgccccgtacgccgac
ctgatctggatggagaccggcacaccggacctggagctggcgcgcaagttcgccgagggc
gtcaaggccgagttccccgaccagatgctggcctacaactgctcgccgtcgttcaactgg
aagcagcacctcgacgacgccaccatcgccaagttccagaacgagctgggtgcgatgggc
ttcaagttccagttcatcacgctggccggcttccacgcgctgaactactcgatgttcgac
ctggcccacggctacgctcgcaaccagatgagcgcctacgtcgagctgcaggagcgcgag
ttcgccgccgaggagcggggttacaccgccaccaagcaccagcgcgaggtcggtgccggc
tacttcgaccggatcgccaccaccgtcgacccgacgtcgtcgaccacggcgctggccggc
tccaccgaagagggccagttccactaa

DBGET integrated database retrieval system