KEGG   Mycobacterium sp. JDM601: JDM601_0477Help
Entry
JDM601_0477       CDS       T01512                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglycerate mutase 1 Gpm1
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    JDM601_0477 (gpmA)
   01230 Biosynthesis of amino acids
    JDM601_0477 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JDM601_0477 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    JDM601_0477 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    JDM601_0477 (gpmA)
Enzymes [BR:mjd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     JDM601_0477 (gpmA)
Exosome [BR:mjd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   JDM601_0477 (gpmA)
  Exosomal proteins of melanoma cells
   JDM601_0477 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
493714..494463
Genome map
AA seq 249 aa AA seqDB search
MSDTATLVLLRHGESEWNASNQFTGWMDVNLTDKGRTEAVRAGHLLVEHDLLPDVVYTSL
LRRAITTANLALDAADRHWIGVHRTWRLNERHYGALQGLDKAATKARYGDEQFMTWRRSY
DTPPPPIEPGSRYSQDTDSRYADIGGGPLTECLADVVARFLPYYTDVIIPELRSGKTVLI
AAHGNSLRALVKYLDGMSDEAVVGLNIPTGIPLRYDLDSELRPKLAGGVYLDPEAAAAGA
AAVASQGAK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacactgccacgctggtgctgctgcgccatggtgagagcgaatggaacgccagc
aaccagttcaccggctggatggacgtcaatctgaccgacaagggccgcaccgaggcggtg
cgcgccggtcacctgctcgtcgagcacgacctgctgcccgacgtggtctacacctcgcta
ttgcgccgggcgatcaccaccgccaacctggcactggacgcggccgaccggcactggatc
ggcgtgcaccgcacctggcggctcaacgaacgccactacggcgcgttgcagggcctggac
aaggccgcgaccaaggcccgctacggcgacgagcagttcatgacgtggcggcgcagctac
gacaccccgccgccgccgatcgagcccggcagccgctacagccaggacactgactcccgc
tacgccgacatcggcggcggcccgctgaccgaatgcctggccgacgtggtggcgcgtttc
ctgccctactacaccgacgtcatcatcccggagctgcgctcgggtaagaccgtgctgatc
gcggcgcacggcaactcgttgcgggccctggtgaagtacctcgacggcatgtcggatgag
gcggtggtgggcttgaacatccccacgggcatcccgctgcgttatgacctggactccgag
ctgcgcccgaagctggccggcggcgtttacctggacccggaggcggccgccgccggagcg
gccgcggtggccagccagggcgccaaatag

DBGET integrated database retrieval system