KEGG   Mycobacterium sp. JDM601: JDM601_0506Help
Entry
JDM601_0506       CDS       T01512                                 

Gene name
hemD
Definition
uroporphyrin-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    JDM601_0506 (hemD)
Enzymes [BR:mjd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     JDM601_0506 (hemD)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     JDM601_0506 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
532433..534082
Genome map
AA seq 549 aa AA seqDB search
MFVGSGPGDPGLLTARARTALTNAALVFVDPDVPEAVLGLVGTDLPPIAGPVPPDPKADK
TDTAQEGAADAEDAAATVPGGPDIRPALGEPAEVAKILTAEARSGADVVRLVAGDPLSVD
SVITEVNAVARTTVQFEIVPGLPATSAVPTYAGLPLGSSHTVADVRDPHVDWAALAAAPG
PLILQATTSHLPEAARTLIEYGLADATPCVVTTSGTTCAQRSVEASLSALTDPASLASID
PVILPNGQETAAGPLVVTIGKTVNNRAKLNWWESRALYGWTVLVPRTKDQAGEMSEKLVG
HGASPVEVPTIAVEPPRSPAQMERAVKGLVDGRYQWVVFTSTNAVRAVWEKFGEFGLDAR
AFSGVKIACVGEATAERVRAFGISPELVPAGEQSSLGLLDEFPPYDDVFDPVNRVLLPRA
DIATETLAEGLRERGWEIEDVTAYRTVRAAPPPATIREMIKTGGFDAVCFTSSSTVRNLV
GIAGKPHARTIVACIGPKTAETAAEFGLRVDVQPETAAVGPLVDALAEHAARLRAEGALP
PPRKKSRRR
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgtcggttcgggtccgggtgacccgggcctgctgacggcgcgggcgcggacggcg
ctgacgaacgccgcgctggtgttcgtcgaccccgacgtgcccgaggcggtgctggggctg
gtcggcacggacctgcccccgatcgccgggccggtgccgccggaccccaaggcggacaag
accgatacggcccaggaaggcgccgccgacgccgaagacgccgccgcgaccgtcccgggc
gggcccgacatccgtcccgcactgggcgaaccggccgaggtggccaagatcctgaccgcc
gaggcgcgctccggcgccgacgtggtgcgtctggtggccggcgacccgctgtccgtcgac
tccgtcatcaccgaggtcaacgcggtagcccgcaccaccgtgcagttcgagatcgtgccg
ggactgcccgccaccagcgcggtgcccacctacgccggcctgccgctcggctcgtcgcac
accgttgccgacgtccgcgacccgcacgtcgactgggccgccctggctgcggccccgggc
ccgctgatcctgcaggccaccacctcgcacctgcccgaggcggctcgcacgctgatcgaa
tacggcctcgcggacgccaccccgtgcgtggtcaccacctcgggcaccacctgcgcacag
cgctcggtggaggccagcctcagcgcgctgaccgacccggcgtcgctggccagcatcgac
ccggtcatcctgcccaacggtcaggagaccgccgccggtccattggtggtgaccatcggc
aagacggtgaacaaccgggccaagctgaactggtgggagagccgcgcgctgtacggctgg
acggtgctggtgccgcgcaccaaggatcaggccggcgagatgagcgagaagctggtcggg
cacggcgcctcgcctgtcgaggtgcccaccatcgccgtggaaccgccgcgcagccccgcc
cagatggaaagggccgtcaagggtttggtcgacggccgctaccagtgggtggtgttcacc
tcgaccaacgcggtacgtgcggtctgggagaagttcggtgaattcgggctggacgcccgc
gcattctccggggtgaagatcgcctgtgtcggcgaagcgaccgccgagcgggtccgggcg
ttcgggatcagccccgagctggtgcccgccggggagcagtcctcgctgggcctgctcgac
gaattcccgccctacgacgacgttttcgatccggtgaaccgggtgctgctgccgcgcgcc
gacatcgctaccgagacgctggccgaggggctgcgtgagcggggttgggagatcgaggac
gtcaccgcctaccgcacggtgcgggccgccccgccgccggcgaccatccgggagatgatc
aagaccggcggattcgacgcggtgtgcttcacgtcgagttccacggtgcgcaacctggtc
ggcatcgccggcaagccgcacgcccgcacgatcgtggcctgcatcggccccaagaccgcc
gagacggcagcggaattcgggttgcgggtcgacgtgcagcccgagacggccgcggtcggt
ccgctggtcgacgcgctggccgagcacgccgcccggttgcgtgccgagggcgccctgccg
ccgccgcgcaagaagagccgccggcgctga

DBGET integrated database retrieval system