KEGG   Mycobacterium sp. JDM601: JDM601_0642Help
Entry
JDM601_0642       CDS       T01512                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit RecD
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mjd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(683046..684800)
Genome map
AA seq 584 aa AA seqDB search
MNTELDPLSWRVARGATGVLREFNEAGVLEAADVHTAQRLCALGAESDETVALAVALAVR
ALRTGSVCVELATVADGTESPELSWPEPAAWLAAVRASSLVAKQVLRIYDNDSGGLLYLD
RYWREEEQVCADLLALSTPQDGSVELPGLERLFPPDHDDQRAAAEIALTQAVTVLTGGPG
TGKTTTVARLLALLAEQAAASGRRPLRIALAAPTGKAAARLTEAVAGVVAGLEPKDQARL
AGLQASTLHSLLGSRPGNSARFKHNRGNRLPHDVIVVDETSMVSLTLMARLLEAVRPTAR
LILVGDPDQLASVEAGAVLADLVDGLAARPGTRVATLVTAHRYKKAIGELASAIRAGDGD
TVIELLRSGDEHREWLDASTPAALGDQLAAIAVPHALRVRQAALLGDAGEALRNLDEHRL
LCAHRDGPHGANHWNHQIRRWVSEQTGDPVWADWYAGRPLLVTANDYGLGVRNGDTGVVV
ARADGLRAVIATASGAVDFATGRLSDVDSMYAMTIHKSQGSEADVVTVLMPPVESRLLTR
ELFYTAVTRAKHQVRVIGSEDEIRAALDRRAVRASGLALRLREA
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgagcttgatccactgtcgtggcgggtggcgcgcggcgccaccggcgtgctg
cgcgagttcaacgaggccggcgtgctggaagccgcggatgtgcataccgcccaacggctc
tgcgcgctgggcgccgaatccgacgagacggtggcgttggcggtggcgctggcggtgcgg
gcgttgcgcaccggctcggtctgcgtggagctggccaccgtggccgacggcaccgagtct
cccgagctgagttggccggagccggcggcctggctggcggcggtgcgcgccagctcgctg
gtcgccaagcaggtgttgcgcatctacgacaacgattcgggcgggctgctgtatctggac
cgctattggcgtgaggaggagcaggtctgcgccgacctgctggcgctgtcgacgccgcag
gacggttcggtcgagctgcccgggctcgaacggctgtttccgccggaccacgacgaccag
cgcgccgccgccgagatcgcgttgacgcaggcggtcacggtgctcaccggcggcccgggg
accggcaagaccaccacggtggcccggttgctggcactgctggccgaacaggccgcggcg
tccgggcggcgaccgttgcggatcgcgctggccgccccgaccggcaaggccgcggcccgg
ctgaccgaggcggtcgccggggtggtggccgggctcgagccgaaagatcaggcccgactg
gctgggctgcaggccagcacgttgcactcgctgctgggttcgcgaccgggaaattcggcg
cggttcaagcacaatcgcggcaaccggctgccgcacgacgtgatcgtggtcgacgagacg
tcgatggtgtcgctgacgctgatggcccggctgttggaggcggtgcggcccaccgcccgg
ctgatcctggtgggcgaccccgaccagttggcgtcggtggaggccggtgcggtgctggcc
gacctggtggacggcttggccgcccgcccgggcacccgggtggcgacgctggtgaccgcg
caccgctacaagaaggcgatcggtgagctggcctcggcgatccgcgccggcgacggcgac
accgtgatcgagctgctgcgctccggcgacgagcaccgggaatggctcgacgcgtcgacc
ccggccgcgctgggcgaccagctggcggcgatcgcggtgccgcacgcgttgcgggtgcgc
caggcggcgctgctcggcgatgccggcgaggcgttgcgcaacctcgacgagcaccggctg
ttgtgcgcgcaccgcgacggcccgcacggggccaaccactggaaccatcagattcggcgg
tgggtgtccgagcagaccggggatccggtgtgggcggactggtatgccgggcggccgctg
ctggtcaccgccaacgattacgggctgggcgtgcgcaacggcgacaccggggtggtcgtg
gcccgcgccgacgggctgcgggcggtgatcgcgacggcgtccggtgcggtggatttcgcc
accggccggctctccgacgtcgacagcatgtacgcgatgaccattcacaagagccagggc
agcgaagccgatgtggtgaccgtgctgatgcccccggtggagtcgcggctgctgacccgc
gagctgttctacaccgcggtgacccgcgccaaacaccaggtgcgggtgatcggctccgag
gacgagatccgtgccgcgctggatcggcgggcggtgcgggcgtccgggctggcgctgcgg
ttgcgtgaggcctga

DBGET integrated database retrieval system