KEGG   Mycobacterium sp. JDM601: JDM601_0673Help
Entry
JDM601_0673       CDS       T01512                                 

Definition
carbohydrate kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    JDM601_0673
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JDM601_0673
   00052 Galactose metabolism
    JDM601_0673
   00500 Starch and sucrose metabolism
    JDM601_0673
   00520 Amino sugar and nucleotide sugar metabolism
    JDM601_0673
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    JDM601_0673
   00524 Butirosin and neomycin biosynthesis
    JDM601_0673
Enzymes [BR:mjd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     JDM601_0673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
715056..715979
Genome map
AA seq 307 aa AA seqDB search
MLALDVGGTKIAAGLVETDGALTYTAVRPTRGDQGAEVVWAVVAELLDDVLARAGGRVRA
VGIGSAGPVDVNAGTVSPINIPGWHGFGLRDRVAAAVPGVPVTLGGDGVCMALGEHRHGA
GRGTRSMLGMVVSTGVGGGLVLDGAPFHGRTGNAGHVGHVVVDPGGQPCRCGGRGCVETV
SSGPSMVRWALANGWGPDGVDGSAADAKALGAAAEAGDPVALRAFRRGTDALAAMIASVA
AVCDLDLVVIGGGVAKSGALLFDPLRAALAEHAGLEFLSGLRVVPAELGGDAGLVGAAAL
VESQHGH
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgcgctcgacgtcggcggcaccaagatcgccgccggcctggtcgagaccgacgga
gccctgacctacacggcggttcggcccacccgcggcgatcagggcgccgaggtggtgtgg
gcggtggtggccgagttgctcgacgacgtcctggcgagagccggcgggcgggtccgcgcg
gtcgggatcggctcggccggacccgtcgacgtgaacgccggcacggtcagccctatcaac
attcccggctggcatgggttcgggttgcgtgaccgggtggccgccgcggtgcccggggtg
ccggtcaccttgggcggtgacggcgtctgcatggcgctgggcgaacaccggcacggcgcc
gggcgcggcacgcggtcgatgctcggcatggtggtctccaccggggtgggcggcggtctg
gtgctcgacggcgcgccgtttcacggccgcaccggcaacgccgggcacgtcggccacgtc
gtcgtcgaccccggcggccagccgtgccggtgcggcgggcgcggctgcgtggagaccgtc
tcctccgggccgtcgatggtgcgctgggcgctggccaacgggtggggcccggatggcgtg
gacgggtcagccgcggacgccaaggcgctcggtgcggccgccgaggccggtgacccggtg
gcgctgcgcgcattccggcgcggcaccgatgcgctggcggcgatgatcgcctcggtggcc
gcggtctgcgatctggatctggtggtgatcggcggcggcgtcgcgaaatccggtgcgctg
ctgttcgatccgctgcgggccgcgctggccgagcacgccgggctggagtttctcagcggg
ctgcgagtggtgcccgccgaactgggtggcgacgccgggctggtgggcgccgcggcgcta
gtcgagtcccagcacggccactag

DBGET integrated database retrieval system