KEGG   Mycolicibacter sinensis: JDM601_0694Help
Entry
JDM601_0694       CDS       T01512                                 

Gene name
rpsL
Definition
(GenBank) 30S ribosomal protein S12 RpsL
  KO
K02950  small subunit ribosomal protein S12
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd03010  Ribosome
Module
mjd_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    JDM601_0694 (rpsL)
Ribosome [BR:mjd03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    JDM601_0694 (rpsL)
  Bacteria
    JDM601_0694 (rpsL)
  Archaea
    JDM601_0694 (rpsL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosom_S12_S23
Motif
Other DBs
NCBI-ProteinID: AEF34694
UniProt: F5Z3G8
Position
738844..739218
Genome map
AA seq 124 aa AA seqDB search
MPTIQQLVRKGRRDKIGKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSQ
VEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGAK
KEKS
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccattcagcagctggtccgcaaaggccgccgcgacaagatcggcaaggtcaag
accgcggccctcaagggcagcccgcagcggcgtggcgtgtgcactcgcgtgtacaccacc
accccgaagaagccgaactcggcgcttcgcaaggtggcccgcgtcaggctgaccagccag
gtcgaggtgaccgcctacatcccgggcgagggtcacaacctgcaagagcactcgatggtg
ctggtgcgtggtggccgggtgaaggacctgccgggtgtgcgttacaagatcatccgcggc
tcgttggacacccagggggtcaagaaccgcaagcaggcccgcagccgctacggcgccaag
aaggagaagagctga

DBGET integrated database retrieval system