KEGG   Mycobacterium sp. JDM601: JDM601_0694Help
Entry
JDM601_0694       CDS       T01512                                 

Gene name
rpsL
Definition
30S ribosomal protein S12
Orthology
K02950  
small subunit ribosomal protein S12
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    JDM601_0694 (rpsL)
Ribosome [BR:mjd03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    JDM601_0694 (rpsL)
  Bacteria
    JDM601_0694 (rpsL)
  Archaea
    JDM601_0694 (rpsL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
738844..739218
Genome map
AA seq 124 aa AA seqDB search
MPTIQQLVRKGRRDKIGKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSQ
VEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGAK
KEKS
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccattcagcagctggtccgcaaaggccgccgcgacaagatcggcaaggtcaag
accgcggccctcaagggcagcccgcagcggcgtggcgtgtgcactcgcgtgtacaccacc
accccgaagaagccgaactcggcgcttcgcaaggtggcccgcgtcaggctgaccagccag
gtcgaggtgaccgcctacatcccgggcgagggtcacaacctgcaagagcactcgatggtg
ctggtgcgtggtggccgggtgaaggacctgccgggtgtgcgttacaagatcatccgcggc
tcgttggacacccagggggtcaagaaccgcaagcaggcccgcagccgctacggcgccaag
aaggagaagagctga

DBGET integrated database retrieval system