KEGG   Mycobacterium sp. JDM601: JDM601_0785Help
Entry
JDM601_0785       CDS       T01512                                 

Gene name
fadB
Definition
fatty oxidation protein FadB
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    JDM601_0785 (fadB)
   01212 Fatty acid metabolism
    JDM601_0785 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    JDM601_0785 (fadB)
   00650 Butanoate metabolism
    JDM601_0785 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    JDM601_0785 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    JDM601_0785 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    JDM601_0785 (fadB)
   00310 Lysine degradation
    JDM601_0785 (fadB)
   00380 Tryptophan metabolism
    JDM601_0785 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    JDM601_0785 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    JDM601_0785 (fadB)
   00281 Geraniol degradation
    JDM601_0785 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    JDM601_0785 (fadB)
Enzymes [BR:mjd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     JDM601_0785 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     JDM601_0785 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     JDM601_0785 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
848088..850235
Genome map
AA seq 715 aa AA seqDB search
MAENTIQWDKDADGIVTLTLDDPTGSANVMNEHYRESMHNAVERLVAEKDSVTGVVITSA
KKTFFAGGDLKAMIHVGPDDAQAVFEQCEGIKADLRALETLGKPVVAAINGAALGGGLEI
ALACHRRIAADAKGSQLGLPEVTLGLLPGGGGVARTVRMLGIQNAFMNVLAQGTRFKPAK
AKEIGLVDEVLPTVEELVPRAKAWIKEELKADPDRVFAQPWDVKGYKMPGGTPSTPSLAA
ILPSFPALLRKQLKGAPMPAPRAILSAAVEGAAVDFDTASRIETRYFVSLVTGHVAKNMI
QAFFFDLQHINGGGSRPDGIGQTPIRKIGVLGAGMMGAGIAYVSAKAGYDVVLKDVSLEA
AQKGKGYSEKLEAKAVERGRTTAEKSSEVLNRITPTGDAADLKGVDFVIEAVFESQDLKH
KVFAEIEDIVEPNALLGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIKGEK
TSDEALARVFDYVLAIKKTPIVVNDSRGFYTSRVIGTFVNEALMMLGEGVEPASIEQAGL
QAGYPAAPLQLCDELNLELMQKIANATREGIEAAGGTLERQRNEEVVDKMIEIGRPSRLS
GAGFYEYVDGKRTGLWPGLRETFNSGSATPPLQDMIDRMLFAEALETQKCLDEGVLTSTA
DANIGAIMGIGFPPWTGGTHQFIVGYPGGQAGFVARAKELAGKYGDRFNPPQSLL
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaacaccattcagtgggacaaggacgctgacggcatcgtcacgctgaccctg
gacgacccgaccgggtcggccaacgtgatgaacgagcactaccgcgagtccatgcacaac
gccgtggaacgtcttgtcgcggagaaggactcggtcaccggtgtggtcatcaccagcgcg
aagaagaccttcttcgccggtggcgacctcaaggcgatgatccacgtcggcccggacgac
gcccaggcggtcttcgagcagtgcgagggcatcaaggctgatctgcgggccctggagacc
ctgggcaagccggttgtcgccgccatcaacggcgccgctctcggtggcggcctggagatc
gcgctggcctgtcaccggcgcatcgccgccgacgccaagggcagccagctcggcctgccc
gaggtcaccctgggcctgctgcccggtggtggcggtgtcgcccgcacggtgcgcatgctg
ggcatccagaacgcgttcatgaacgtgctggcgcagggcacccgcttcaagcccgccaag
gccaaggagatcggcttggtcgatgaggtgcttccgacggtcgaggagctggttccgcgc
gccaaggcttggatcaaggaggagctcaaggccgacccggaccgtgtcttcgcccagccg
tgggatgtcaagggctacaagatgcccggcggcaccccgtcgaccccgtcgctggcggcg
atcctgccgtcgttcccggcgctgctgcgcaagcagctcaagggtgctccgatgcccgcg
ccgcgggccatcctgtccgccgcggtcgagggtgcggcggtggacttcgacaccgccagc
cgcatcgagacccgctacttcgtctcgctggtcaccggccacgtcgccaagaacatgatc
caggcgttcttcttcgacctgcagcacatcaacggcggcggcagccggcccgacggcatc
gggcagaccccgatccgcaagatcggtgtgctcggcgccgggatgatgggcgccggcatc
gcctacgtgtcggccaaggccggctacgacgtggtgctcaaggacgtctccctggaggca
gcgcagaagggcaagggctactcggagaagctggaggccaaggccgtcgagcggggtcgc
accaccgctgaaaaatccagcgaagtcctcaatcggatcaccccgaccggggatgcggcc
gacctcaagggcgtcgacttcgtgatcgaggcggtgttcgagagccaggacctcaagcac
aaggtgttcgccgagatcgaggacatcgtcgagcccaacgcgctgctgggatccaacacc
tccaccctgccgatcaccggtctggcgaccggcgtgaagcgccaggaggacttcatcggc
atccacttcttctcgccggtcgacaagatgccgctggtggagatcatcaagggcgagaag
acctctgacgaggcactggcccgggtgttcgactacgtgctggccatcaagaagaccccg
atcgtggtcaacgacagccgcggtttctacaccagccgtgttatcggcaccttcgtcaac
gaggcgctgatgatgctcggcgagggtgtggagccggccagcatcgagcaggccggtctg
caggccggctacccggcagctccgctgcagctctgcgatgagctcaacctggagctgatg
cagaagatcgccaacgccacccgtgagggcatcgaggcggccggcggcacgctcgagagg
cagcgcaacgaagaggtcgtcgacaagatgatcgagatcggtcgcccgtcgcgcttgtcg
ggtgccggcttctacgagtacgtcgacggcaaacgcaccgggctgtggccggggctgcgg
gagaccttcaactcgggcagcgccaccccgccgctgcaggacatgatcgaccggatgctg
ttcgctgaggcgctggagacccagaagtgcctcgacgaaggcgtgctgacctcgaccgcg
gacgccaacatcggcgcgatcatgggcatcgggttcccgccgtggaccggcggcacgcac
cagttcatcgtcggctaccccggcggacaggccggcttcgtggcgcgggccaaggagctg
gccggcaagtacggcgaccggttcaacccaccacagtcgctgctgtaa

DBGET integrated database retrieval system