KEGG   Mycobacterium sp. JDM601: JDM601_0941Help
Entry
JDM601_0941       CDS       T01512                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    JDM601_0941 (galU)
   00052 Galactose metabolism
    JDM601_0941 (galU)
   00500 Starch and sucrose metabolism
    JDM601_0941 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    JDM601_0941 (galU)
Enzymes [BR:mjd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     JDM601_0941 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1012523..1013395
Genome map
AA seq 290 aa AA seqDB search
MPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAEAGAERLVIITSEGKDGVVAHF
VEDLVLEGTLEARGKKAMLAKVRRAPQLIKVESVVQAEPLGLGHAISCVEPTLSADEDAV
AVLLPDDLVLPTGVLETMSKVRGLRGGTVLCAIEVSPDEVSAYGVFDVEPVPDGDNPDVL
RVKGMVEKPKAADAPSMYAAAGRYVLDRAVFDALRRIDRGAGGEVQLTDAIALMIAEGHP
VHVVVHRGSRHDLGNPGGYLKAAVDFALDRDDYGPDLRRWLVARLGLAEN
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgccggcggccggtttgggtacccgttttctgccagccaccaagacggtgcccaaggag
ttgctgcccgtcgtcgacaccccggggatcgagttggtggccgccgaggcggccgaggca
ggcgccgagcgactggtgatcatcacctcggagggcaaggacggggtggtcgcgcacttc
gtcgaagacctggtgctggaaggcacgctggaggcgcgcggcaagaaggcgatgctggcc
aaggtgcgccgcgccccgcaactgatcaaggtggagtcggtggtgcaggccgagccgctg
gggctggggcacgccatcagctgtgtcgagcccacgttgtccgccgacgaggatgcggtc
gccgtcctgctccccgacgacctggtactgcccaccggggtgttggagacgatgtcgaag
gtgcggggcctccggggcggcaccgtgctatgtgcgatcgaggtcagccccgacgaggtc
agcgcctacggcgtttttgacgtcgagcccgttcccgacggtgacaatcccgacgtgttg
cgggtcaagggcatggtggagaagcccaaggcagccgacgcgccatcgatgtatgccgcc
gcgggccgctacgtgctggaccgtgcggtgttcgacgcgttgcggcgcatcgaccgcggc
gccggcggggaggtgcaactcaccgacgccatcgcgctgatgatcgccgagggccacccc
gtccatgtcgtggttcaccgcggctcgcgacacgacctgggaaatccgggcggctacctc
aaagctgcggttgactttgccctggatcgtgatgactacggtccggacctgcgccggtgg
ttggtggcgcggttgggcttggcggagaactga

DBGET integrated database retrieval system