KEGG   Mycobacterium sinense: JDM601_0941Help
Entry
JDM601_0941       CDS       T01512                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase GalU
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mjd  Mycobacterium sinense
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    JDM601_0941 (galU)
   00052 Galactose metabolism
    JDM601_0941 (galU)
   00500 Starch and sucrose metabolism
    JDM601_0941 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    JDM601_0941 (galU)
Enzymes [BR:mjd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     JDM601_0941 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1012523..1013395
Genome map
AA seq 290 aa AA seqDB search
MPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAEAGAERLVIITSEGKDGVVAHF
VEDLVLEGTLEARGKKAMLAKVRRAPQLIKVESVVQAEPLGLGHAISCVEPTLSADEDAV
AVLLPDDLVLPTGVLETMSKVRGLRGGTVLCAIEVSPDEVSAYGVFDVEPVPDGDNPDVL
RVKGMVEKPKAADAPSMYAAAGRYVLDRAVFDALRRIDRGAGGEVQLTDAIALMIAEGHP
VHVVVHRGSRHDLGNPGGYLKAAVDFALDRDDYGPDLRRWLVARLGLAEN
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgccggcggccggtttgggtacccgttttctgccagccaccaagacggtgcccaaggag
ttgctgcccgtcgtcgacaccccggggatcgagttggtggccgccgaggcggccgaggca
ggcgccgagcgactggtgatcatcacctcggagggcaaggacggggtggtcgcgcacttc
gtcgaagacctggtgctggaaggcacgctggaggcgcgcggcaagaaggcgatgctggcc
aaggtgcgccgcgccccgcaactgatcaaggtggagtcggtggtgcaggccgagccgctg
gggctggggcacgccatcagctgtgtcgagcccacgttgtccgccgacgaggatgcggtc
gccgtcctgctccccgacgacctggtactgcccaccggggtgttggagacgatgtcgaag
gtgcggggcctccggggcggcaccgtgctatgtgcgatcgaggtcagccccgacgaggtc
agcgcctacggcgtttttgacgtcgagcccgttcccgacggtgacaatcccgacgtgttg
cgggtcaagggcatggtggagaagcccaaggcagccgacgcgccatcgatgtatgccgcc
gcgggccgctacgtgctggaccgtgcggtgttcgacgcgttgcggcgcatcgaccgcggc
gccggcggggaggtgcaactcaccgacgccatcgcgctgatgatcgccgagggccacccc
gtccatgtcgtggttcaccgcggctcgcgacacgacctgggaaatccgggcggctacctc
aaagctgcggttgactttgccctggatcgtgatgactacggtccggacctgcgccggtgg
ttggtggcgcggttgggcttggcggagaactga

DBGET integrated database retrieval system